KEGG   Sinocyclocheilus rhinocerous: 107756441
Entry
107756441         CDS       T04916                                 

Definition
(RefSeq) nitric oxide synthase, inducible-like
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00220  Arginine biosynthesis
srx00330  Arginine and proline metabolism
srx01100  Metabolic pathways
srx04020  Calcium signaling pathway
srx04146  Peroxisome
srx04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107756441
   00330 Arginine and proline metabolism
    107756441
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107756441
   04020 Calcium signaling pathway
    107756441
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107756441
Enzymes [BR:srx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     107756441
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 107756441
NCBI-ProteinID: XP_016429032
LinkDB
Position
Unknown
AA seq 1127 aa
MGNQATKSNKNVILHQIKPNTQRENNNVILKQITPNTQLENNNVILQQITPNTQWENKKV
ILQQITPSTQWENKVNQCPFSKQVKNYQDGLCHQDTLHHRAVKSQICMSEVCEGSIMTPK
AMTRCPSSTLPGSDDNLMQAIDFINQYYKSIKNSKIEEHLSRLEEVAKEIEATGSYQLTT
KELEFGAKQAWRNAPRCIGRVQWANLQLFDARKCRTAEDMFQMLCDHIQFATNGGNLRSA
ITVFPQRTEGQHDFRVWNSQLIRYAGYKMTDGTIIGDPASVDFTEICIQLGWTPKYGQFD
VLPLVLQANSEDPQCFEVPQHLILEVPMEHPQYKWFKDLNLRWYALPAVSNMLLEIGGLE
FPACPFNGWYMGTEIGVRDFCDTKRYNVLERVGRLMGLETQKLSSLWKDQALVAINVAVM
HSFQKNKVTITDHHSASESFMQHMEMEVRLRGGCPADWVWLVPPMSGSLTPVFHQEMLNY
ILSPFFYYQPEPWLTHKWKNKKRNVRKHTISFKGLIRVVLFSQILIKSALAKRVRCTVLY
ATETGKSQTFAKRLNTMMNCAFSSQVVCMEDYNFSELEKESLLIVVTSTFGNGDCPGNGE
SFKKQLLSLNNLRNKVRYCVFGLGSRMYPHFCAFAHAVDDRFAALGAIRVSATGEGDELN
GQEEAFSAWACTAFKNACKEFNIQGQLPGKEGLADSWDPQRHRVQNDSCTVDQITALSAL
HSKVVVPMKLKRKQNLQSPKSSRATILVELEMDGNTERLNFVPGDHVGIFPGNSSELVAG
ILKHLASAPPINQSLSLEFLSAYPDGERWQRVERIPPCPLAQALTYYLDVTTPPSQSLLR
KLSKMAKLEDHRQRLLALATDFQVYATWKEFHKPTFLEVLDEFSSLEISAAFLLSQLPLV
KPRLYSISSSPDLHPQELHLTVAVVSYHTQEGKGPLHFGLCSTWLNTIKEGDMVPCFVHS
SDGFHLPSDPSAPCILVGVGSGIAPFRSFWQQQFHDMKKTGLKGNPMTLVFGCRGSDTDH
LYKEETLDMRDNGTLSSITTAYSRQTGQPKVYVQDILREQLSDKVFEVLHHNPGHLYICG
GMNMAHDVAATIKEILVSRQGITLTQAEEYLSRLKNEKRYHEDIFGS
NT seq 3384 nt   +upstreamnt  +downstreamnt
atggggaaccaagccactaaatccaacaagaatgtaatactgcaccagattaagccgaat
acgcaacgggagaacaataatgtaatactgaagcagattacgccaaatacgcaattggag
aacaataatgtaatactgcagcagattacaccgaatacgcaatgggagaacaagaaagta
atactgcagcagattacgccaagtacgcaatgggagaacaaggtgaatcaatgcccattt
tccaagcaagtgaagaactaccaggatggcttgtgccatcaggacacattacatcacaga
gcggttaagagccagatttgcatgtctgaagtctgtgaaggctctattatgactccaaag
gctatgacacgctgtccctcctccaccctgccaggctccgatgacaacctcatgcaagct
attgacttcatcaatcagtactacaagtcaattaaaaactcaaaaatcgaggagcacctg
tctcgtttggaggaagtcgcaaaggaaatagaggctactggctcatatcaactcaccaca
aaagaactggaatttggggctaagcaagcatggagaaatgcacctagatgcattggcaga
gttcagtgggctaatttgcagctgtttgatgcacgtaaatgcagaactgctgaggatatg
tttcagatgttgtgcgatcatattcagttcgctaccaatggaggcaacctgaggtctgcc
atcactgtgtttcctcaaagaactgaaggccaacatgatttccgtgtatggaatagtcag
ctcatacgatacgctggctataaaatgacagatggtacgataataggagatcctgccagt
gttgacttcacagagatttgcatccagcttgggtggacaccaaagtatggtcaatttgat
gtgcttccactggtgttacaagctaacagtgaggaccctcagtgttttgaagttccccaa
catttgattttggaagttcccatggagcacccacagtacaagtggtttaaggatttgaac
ctccgatggtatgcattgcctgcggtgtccaacatgttgctggagattggtggtcttgaa
ttcccagcgtgtccttttaacggttggtacatgggcactgagattggagtgagggacttc
tgtgataccaaacgctacaatgttcttgagcgggttggccgtctaatgggtttggagaca
caaaaactatcctcgctatggaaggatcaggctctggtggccatcaatgtcgcagtgatg
catagttttcagaaaaataaggtcaccattaccgaccaccattctgcatcagagtccttc
atgcagcacatggagatggaggtacgtctgcgaggaggctgtccagctgactgggtctgg
ctggtgccaccgatgtctggatctctaacccctgtgtttcaccaggaaatgctgaactac
attctgtcaccctttttctactaccagcctgaaccgtggttgacacacaagtggaagaac
aagaagagaaatgtgaggaagcatacaatcagcttcaaaggactgatcagagtagtgctc
ttctctcagatactcattaaatcagccctggccaagagggtgcgttgcactgttctctac
gccacagaaacagggaaatcacagacttttgctaagagactaaacaccatgatgaactgt
gccttcagctcccaggtcgtttgcatggaggactacaacttcagtgaacttgagaaggaa
agcctgttaattgttgtcaccagcacctttggcaatggagactgtccaggaaatggagag
agtttcaagaagcagcttctcagcctgaacaacctcagaaataaagtcaggtactgtgtg
tttggtctcggctctcgaatgtacccacacttctgtgcgtttgcccatgcagtggatgat
aggtttgcagcactgggagccattcgtgtgtctgccacaggagagggagatgagctgaac
ggacaggaggaagctttctcagcctgggcttgcactgcctttaagaatgcatgcaaggag
tttaatattcaaggtcagcttccaggaaaagaaggtctggcagattcctgggatccacag
aggcacagagttcagaatgacagttgtacagttgaccaaatcacagctctgtcagctctc
cattctaaagttgtggttcccatgaaactaaagagaaagcagaatctacagagcccaaag
tcaagtcgtgctacaatattggtggagttagagatggatgggaacacagagcgcttaaac
tttgtccctggagaccatgtagggattttcccagggaactcatctgaattagtagctggc
atcctgaagcatctggccagtgcccctcctataaatcagagcctaagcttggaattcctc
agtgcctaccctgatggtgaaaggtggcagagagttgaacgaataccaccatgtcctctt
gcccaagctcttacctactatctggatgtcaccaccccaccctcacaaagcctcctccgc
aaactctcaaagatggcaaagcttgaagatcacagacagcgcctgcttgcattagcaaca
gatttccaagtctacgcaacatggaaggagttccacaaacctactttccttgaggtgcta
gatgagttttcctctctggaaatttctgctgcctttctcctcagccagctgcctctagtg
aagccacgtctctactccatcagctcctccccagacctccaccctcaggagctccacctc
actgtggccgtggtcagctatcacacacaggagggaaaaggtccgctgcattttggtctt
tgtagtacctggctcaataccatcaaagaaggagacatggtgccatgttttgtccatagc
tctgatggtttccaccttccatccgaccctagtgctccctgtattcttgtgggagttggg
agcggcattgctccattccgtagcttttggcaacagcaattccatgacatgaaaaaaaca
ggtctgaaagggaatccaatgacactcgtgttcgggtgtcgaggttcagatactgatcat
ctttacaaagaagagactctggacatgagagataatggtaccctaagcagtatcacaacc
gcttactctaggcagactggacaacccaaggtttatgtccaagatatcttgcgagaacaa
ttgagtgacaaggtctttgaggttctgcaccataatccaggacatctgtatatctgtgga
ggcatgaacatggcccatgatgtggctgccactatcaaggaaatcctagtcagccggcag
ggcatcactcttactcaggctgaggaatatctgtcaaggctcaagaatgaaaagcggtac
catgaggacatctttggatcctag

DBGET integrated database retrieval system