KEGG   Sinocyclocheilus rhinocerous: 107756775Help
Entry
107756775         CDS       T04916                                 

Definition
(RefSeq) NADP-dependent malic enzyme, mitochondrial-like isoform X1
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00620  Pyruvate metabolism
srx01100  Metabolic pathways
srx01200  Carbon metabolism
srx03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    107756775
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    107756775
Enzymes [BR:srx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     107756775
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malic_M malic
Motif
Other DBs
NCBI-GeneID: 107756775
NCBI-ProteinID: XP_016429505
LinkDB All DBs
Position
Unknown
AA seq 603 aa AA seqDB search
MNSLSGKSVLALCRVFSSPLSLPPAMVGAVRVCHSGVNSKGTVFTKKRGYDITRNPHLNK
GMAFTLEERLQLGIHGLLPPCFLSQDVQVLRVMKSYETRSNPLDKYILLMTLQDRNEKLF
YRVLTSDVEEFMPIVYTPTVGLACQQYGLAFRRPRGLFITIHDKGHIASMLNSWPEENIK
AIVVTDGERILGLGDLGSYGMGIPVGKLALYTACGGVPPQQCLPVLLDVGTDNQNLLDDP
LYIGLKHKRVRGKEYDDLIDEFMQAVTDKYGMNCLIQFEDFANSNAFRILNKYRNHYCTF
NDDIQGTASVAVAGVLAALKITKNKLSDHKFVFQGAGEAALGIAHLMIMAMAKEGVPHAE
AVKRIWMVDSKGLIVKGRSHLNHEKEEFAQDHPHIKTLEEVVETIKPTAIIGVAAISGAF
TEKIIKTMATFNERPIIFALSNPTSKAECTAEQCYTLTEGRGIFASGSPFKKVTLADGRS
FYPGQGNNAYVFPGVALGVIACGVRHISDNIFLTTAEAISDMVTEEHLAEGRLYPPLKTI
REVSFKIAVKIVDHAYKQGIASWYPEPKDKEAFILSQVYNSDYDSFTLDSYSWPKDAMTV
QNV
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgaactctctctcgggtaagagtgtgctggcgctgtgcagggttttctccagtcccctg
tctctccctcctgctatggtaggggcagtgagggtctgtcactcaggcgtgaactccaag
ggcacggtgttcaccaaaaaacgaggctatgatatcaccaggaacccccacttgaacaaa
ggcatggcgttcaccctggaggagaggttacagctgggtatccacggcctgctgcctccc
tgtttcctctctcaggatgtccaagtgcttcgtgtcatgaagagctatgagacacgcagt
aaccctcttgacaaatacatattgctgatgaccctgcaagacagaaatgagaagcttttc
tatcgtgtgttaacctctgacgtagaggaatttatgcctattgtctacactcctactgtg
ggcctggcctgccaacagtatggccttgctttcagaagaccaagagggctgtttatcact
atccatgacaaggggcatattgccagcatgctgaactcatggccggaggaaaacattaag
gccatagtggtgacggatggagaacgaatcctgggattaggagacctaggcagctatgga
atggggatcccagtgggcaaactagctctgtatacagcatgtggaggagtgccacctcag
cagtgcctgcctgtgctgctagatgtgggcactgataatcagaacctcttagatgacccc
ttgtacatcggcttaaagcacaaaagagtgaggggcaaagaatacgatgacctcattgat
gagttcatgcaagctgtcaccgacaagtatgggatgaattgcctaattcagtttgaggat
tttgccaacagcaatgcctttcgtattctcaataaataccgcaaccattattgcaccttt
aatgatgatatccagggcacagcttctgttgctgttgctggggtccttgctgctcttaag
attactaagaataaactctctgaccacaagttcgtatttcagggagcaggagaggccgca
ttgggcattgctcacttaatgataatggccatggccaaggaaggtgtacctcatgctgag
gctgtcaagaggatttggatggtggattctaaaggcctaattgtcaagggcagaagtcat
ctgaaccatgagaaggaagaatttgcccaagatcatccacacataaagactctagaggaa
gtggtggaaaccatcaagcccacagctatcattggtgtggctgctataagtggtgctttc
actgagaagatcatcaagaccatggctactttcaacgaacgcccaattatttttgccctc
agcaatcccacaagcaaagctgagtgcacagcagagcagtgttacacactcactgaggga
aggggcatatttgccagcggaagcccttttaagaaagtcactttggcagatggtcgtagc
ttctaccctggccagggaaacaatgcttatgtgttccctggagtagcattgggagtcatc
gcctgtggtgttcgccacatctcagataacatttttcttactacagcagaggcgatttct
gacatggttactgaggagcatctggctgagggcagactgtacccccctctgaagaccatc
agagaagtatccttcaaaattgctgttaagattgtggaccatgcctacaaacagggcatt
gcctcctggtatcctgaacccaaagacaaagaggcctttattttatcccaagtctataac
tctgactacgactccttcactctggattcatacagctggcccaaggatgccatgacagtt
cagaacgtgtag

DBGET integrated database retrieval system