KEGG   Sinocyclocheilus rhinocerous: 107758095Help
Entry
107758095         CDS       T04916                                 

Definition
(RefSeq) metalloproteinase inhibitor 3-like isoform X1
  KO
K16866  metalloproteinase inhibitor 3
Organism
srx  Sinocyclocheilus rhinocerous
Brite
KEGG Orthology (KO) [BR:srx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:srx01002]
    107758095
Peptidases and inhibitors [BR:srx01002]
 Peptidase inhibitors
  Family I35: timp family
   107758095
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIMP
Motif
Other DBs
NCBI-GeneID: 107758095
NCBI-ProteinID: XP_016431241
LinkDB All DBs
Position
Unknown
AA seq 145 aa AA seqDB search
MGVPVSAAVTLGLLFFLSAGLNEQVAEGCKCLPRHPQQVFCESDIGRVMDGVIVFGLCDF
MWPWDQLSSVQKGNLNMYRRGCVCEIASCTGASCLTKKLQRKCLIGVNNFLGLVYEEALQ
SVCLPCRDGFCRWRKMIGNYKSSLK
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcccggtgtctgctgctgtgactctagggctgctgttcttcttgtctgcggga
ctgaacgagcaggtggccgagggctgtaaatgtcttccaagacaccctcaacaggtgttc
tgcgagtctgatataggacgtgtcatggatggagtgattgtttttggtttatgtgacttt
atgtggccttgggaccaactctcctcggttcaaaaggggaacctcaacatgtatcggaga
ggctgtgtctgtgagattgcatcctgtactggagcgtcctgtttgaccaagaagcttcaa
agaaagtgtctgataggagtcaataatttcctcggtcttgtttatgaagaggctcttcag
tctgtgtgcctgccatgcagagacggcttctgcagatggcgaaaaatgattggtaactac
aaaagctcgctaaaatga

DBGET integrated database retrieval system