KEGG   Sinocyclocheilus rhinocerous: 107758119Help
Entry
107758119         CDS       T04916                                 

Gene name
gaa
Definition
(RefSeq) lysosomal alpha-glucosidase isoform X1
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00052  Galactose metabolism
srx00500  Starch and sucrose metabolism
srx01100  Metabolic pathways
srx04142  Lysosome
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107758119 (gaa)
   00500 Starch and sucrose metabolism
    107758119 (gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107758119 (gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107758119 (gaa)
Enzymes [BR:srx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107758119 (gaa)
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107758119 (gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 107758119
NCBI-ProteinID: XP_016431267
LinkDB All DBs
Position
Unknown
AA seq 929 aa AA seqDB search
MARICCGPLHTFALLTSVLILVHKDKNVSFAFSPSAEWQHSSNISYRSIPFRKNLSNNVN
VSADPRTHTSLVSDQCGIAVESRIDCGRDRSLSRADCEGRGCCYVPLPQSGLGGPPWCFY
PVRYPGYKMGPLLPTEKGQRATLARSEPSYLPRDIPTLQLDVMPETLGRLHLTLKDPASP
RYEVPFVTSQSRGHKDIQNPLYDVDFQPDPFGFIVRRKSNGRVLLNTTIGPLLFADQYLQ
LSTSMASSAISGLGEHYTPITLDLNWSSVSLWNRDMAPHRSANLYGSHPFFLVQEGDGQA
HGVFLLNSNAMEVFLQPAPALTWVTVGGILDFYIFLGPSPQSVVQQYHEVIGYPMMPPYW
SLGFHLCRWGYTSTNITRTVVQLMRQAKIPLDVQWNDLDYADQRRVFTFDPQRFGDLPQM
VEEFHQLGMKYVLILDPGISSASPPGSYKPFDDGLKRGVFIKNSTGQILIGKVWPGPTAF
PDFTNPTTQDWWMDCIRVFHSKVPVDGLWIDMNEPSNFVQGSVDGCPDSDLEKPPYTPGV
IGGQLNSGTLCVSAQQYLSNHYNLHNLYGLTEAIATHRALLKVKSTRPFVLSRSSFPGLG
RFSAHWTGDVRSDWEQLRFSIPGVLLFGLYGIPLVGADVCGFGGDTTEELCVRWTQLGAF
YPFMRNHNDRPNAPQEPYVFSQQAQDAMRTAITLRYSLLPFLYTLFHHTHSSSSTVARPL
FLEFPTDPNCQSIDRQFLWGSSLLISPVLEEGAVQVTAYLPPGTWYSLHNGEAYCSKGQC
ILFPAPLDTINVHVREGSIIPQQVPALTTTASRRNPFTLIVALSVGNWAKGELFWDDGES
LDTFEHGHYSYVLFFAQESYVVSKPVKLNGSLDGLVLGEVRVFGVQASPTAVWANGQKVH
DFSYSPDTKVLTVPGLDSPMTAMITVQWS
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atggccaggatctgctgtgggcccctgcacacatttgcactactgacttctgtacttatt
ctggtgcacaaggacaagaacgtttcatttgccttttctccatcagcagaatggcagcat
agttcaaacatctcatacaggagcattccgttccgaaagaacttaagcaataatgttaat
gtatctgctgatcccaggactcacactagtttagtcagcgatcagtgtggtatagctgtg
gagagccgcatcgactgtggccgtgatagatctttgagccgggctgattgtgagggcaga
ggatgctgctatgtgcccctgcctcagtctggattaggaggaccaccgtggtgtttctac
ccagtccgttacccaggctacaagatggggcccctgttgcccacagagaagggccaaaga
gccaccctggcccgttctgaaccctcatacctgccccgggacatccccacactgcagcta
gatgtgatgcctgagactttgggtcgtcttcacctcactctgaaagatccagcatctcca
cgatatgaggttccctttgtgacgtcccaatccaggggccacaaggacattcaaaacccc
ctctatgatgttgacttccaaccagatccatttggattcattgtacggcgaaaatccaat
ggccgggttcttctgaatactacaataggcccgctcctgtttgcagatcagtatctacag
ctctccaccagcatggcttcctctgcgatatctggcctgggtgaacattacacccccatc
acgctggacctcaactggagctctgtttcattatggaacagagacatggcgccacataga
agcgccaacctgtacggctcccaccctttctttttggtccaagaaggtgatggacaggca
catggagtctttcttctcaacagcaatgcgatggaagtgtttctgcagcccgctccagca
ttaacttgggtgactgtcggaggaatactggacttctacatcttcttaggcccaagtcct
cagagtgtggttcagcagtaccatgaggttataggttatcccatgatgccaccctactgg
tcactgggcttccacctctgtcgctggggttatacgtccaccaacataacaagaacagtg
gtacagctcatgcgccaggccaagatccctctagacgtacagtggaatgaccttgattat
gcagaccaaagaagagtctttacgtttgatcctcaaagatttggagatttgccccaaatg
gttgaagagttccatcagctgggcatgaagtatgtgctcattctggatccaggcatcagc
agtgcgagtcctcctggttcatacaaaccctttgatgacgggctgaagaggggagtgttc
atcaaaaactccactggacagatccttattgggaaggtatggccgggtccaactgcattc
ccagatttcaccaatcccacaacacaggactggtggatggactgcatcagagtctttcac
agcaaggtacctgtggatggactctggatagacatgaatgagccatcaaattttgtgcag
ggctctgtggatgggtgtcctgactctgacttggagaaaccaccttatacaccaggtgtg
atcggaggtcagttaaactcaggaactctgtgtgtgtcagcacagcagtatctgtccaat
cattacaatctgcacaatctgtatgggctgaccgaggccatcgccacccacagggcactg
ttgaaagtgaagagtactcggccgtttgtcctgtcccggtcgtcttttccaggactgggc
cgtttctctgcacactggactggagatgtgcggagtgactgggagcaactgcgcttttca
atacctggtgtgctcctgtttggactctatggcatcccgttagtgggagctgatgtctgt
gggtttggtggagacactactgaagagctgtgtgtgcgctggacacaacttggagccttt
tacccctttatgagaaaccataatgacagacccaatgcgccccaggagccgtatgtattt
agccagcaagcccaggatgccatgaggactgcgattacactgcgatactctctgctgccc
ttcctctacacactgttccatcacacacactcctccagcagcaccgtggcccgtcctctc
ttccttgagtttcccactgatccaaattgccagagcattgacaggcagttcctgtggggg
agttcactgcttatcagtcccgttctggaagagggagcggtgcaggtgacggcctatctt
cccccggggacttggtacagtctgcacaatggggaagcatattgcagtaaagggcaatgc
attctgttccctgctcctttagacaccattaacgttcatgtgagagaagggagcatcatc
ccgcagcaggttcctgcattgacgactacagcatctcgcaggaatcctttcaccctaatc
gtggcactgtctgtgggaaattgggctaaaggggagctcttctgggatgatggggaaagt
ctggacacttttgagcatggacattattcatatgttctgttctttgctcaagagtcttat
gtggtcagtaagccagtcaaattaaatggatctctcgatggtttggtactcggggaagta
cgtgtttttggggttcaggcttcacctacagccgtgtgggccaatggccaaaaggttcat
gacttctcttacagcccagacaccaaggttctgacagtgccaggtctggactcacccatg
acagccatgatcacagtacagtggagctga

DBGET integrated database retrieval system