KEGG   Sinocyclocheilus rhinocerous: 107758384
Entry
107758384         CDS       T04916                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-like isoform X1
  KO
K04291  lysophosphatidic acid receptor 2
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04080  Neuroactive ligand-receptor interaction
srx04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107758384
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107758384
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:srx04030]
    107758384
G protein-coupled receptors [BR:srx04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    107758384
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 107758384
NCBI-ProteinID: XP_016431586
UniProt: A0A673J9D2
LinkDB
Position
Unknown
AA seq 370 aa
MVCHDNESVKFFYDISKKNISETWQTKDFVVVSLGLLVCAFVIFANILVMLAIFMNRRFH
YPIYYLLGNLAAADLFSGISYMYLMFHTGPWTSKLSVSQWFVRQSLIDTSLTASVINLMA
IALERHQTIFTMQLHSKMTNHRVVLLIIGIWLIAIVLGLVPSMGWSCVCNTMECSNMAPL
YSRSYLVFWAVLNLLTFTIMVAVYTRIFVYVRRKSHRMSQHTSQIKHKETVVNLMKTVVM
ILGCFVVCWTPGLVLLLLDGSCESCDVLTYEKFFLVLAECNSFMNPIIYSYRDKDMRHTF
KRILCFPCVGSQQEGEHSGVRFNTLEQERRRRVLQESWVARRARDADGAPATGGRLVLKE
AEHMLDYTES
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggtttgccatgacaacgagagcgtgaagttcttctacgacatcagcaagaagaacatc
agcgaaacgtggcagactaaagacttcgtggtggtttctctgggcctgctggtctgtgct
ttcgtcatcttcgccaacatcctggtcatgctggccatcttcatgaaccgcaggttccac
taccccatctactacctgctggggaacctggcggcggccgacctgttctccggcatctcc
tacatgtacctgatgttccacacgggcccctggaccagcaagctctccgtcagtcagtgg
tttgtgcggcagagtttgatcgacaccagtctgacggcgtcggtcattaatctgatggcc
atcgcgctggagcgccaccagaccatcttcaccatgcagctgcacagcaaaatgaccaac
caccgggtggtgctgctgatcatcggcatctggctcatcgccatagtgctgggtttggtg
ccctctatgggatggagctgcgtgtgcaacaccatggagtgctcaaacatggcaccgctc
tacagccgcagctacctggtgttctgggccgtgctcaacctgctgaccttcaccatcatg
gtggccgtatacacacgcatcttcgtctacgtgcgccgcaagagccaccgcatgagccag
cacacctcacagatcaagcacaaggagacggtggtcaacctgatgaagaccgtcgtcatg
atcctgggttgtttcgtggtgtgttggacgccggggctggttctgcttctcctggacggt
tcgtgtgagtcctgcgacgtcctgacctacgagaagttcttcctggtgctggccgagtgc
aactccttcatgaaccccatcatctactcctaccgcgacaaggacatgcgccacaccttc
aagcgcatcctctgcttcccgtgtgtggggtcgcagcaggagggcgagcactcgggcgtg
cgcttcaacaccctcgagcaagagcggagacggcgcgtgctgcaggagtcatgggttgct
cgtagggctcgtgatgcagacggcgcgccggctaccggaggacggctcgtgctgaaggag
gcggagcacatgctggactacaccgagagctga

DBGET integrated database retrieval system