KEGG   Sinocyclocheilus rhinocerous: 107758578Help
Entry
107758578         CDS       T04916                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD1B-A-like
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107758578
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:srx03036]
    107758578
Enzymes [BR:srx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107758578
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107758578
   HMT complexes
    COMPASS/SET1 complex
     107758578
    COMPASS/SET1 complex (yeast)
     107758578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1
Motif
Other DBs
NCBI-GeneID: 107758578
NCBI-ProteinID: XP_016431837
LinkDB All DBs
Position
Unknown
AA seq 1716 aa AA seqDB search
MSRPGERNKLNEDHGRRQSSSLANGMENSHPICSSGEKRSHHWRSYKLIIDPALKKGSHK
LYRYDGQNFSLPNPGMPPVDNVRDPRIGRMWTKYKETDLPVPKFKIDECYIGRVPPKEVT
FAKLNDNVREGFLTDMCKKFGDIEEVEILYNPKNKKHLGIAKVVFGAVKAAKDAVQNLHN
TSVMGNIIHVELDPKGEHRQRYFQRLINGSYTPLTLPVGGEEACEVSPRSLAEALLPLRR
LSEGSSSAVGGTATPGGTNTPMSLDTAYSSLRQDTPQSQGTPHTPRPSGTPFSQDSSYSS
RQGTPAFQSNRAESSGGYKSRRHETKFQDAYNRRPERHYVHGTGGGAHRGNAEQPPSFKQ
HQPPEPPSPAFAHTPPPPASANFKNAFSPYQPPMPPVYPHTEPSFHQPVQREVDYRRPPQ
APPPPSTDFMPVRDRPATPPIPEPPPPAPEAGGHQSSGEDMEISDDEMPGTPIASGDCAK
NIVVNSAMSPMQTIPMPPPGFPPLPHPQAGFPLPLHPLPTVPHLAGPHPMLHPLHPYPPG
MMPIMQMDLMSSLPQWGSIHMSFQMQTQMLSRMAQSQRPYPYPHFISGAAASAGAAAAAA
MQFGSPYPPLSMVGAPAGTVGHGQPWPLPNMPKFNPAVPPPGYEPQKEDPHKATVDGVLM
VIVKELKAIMKRDLNRKMVEVVAFRAFDEWWDKQERSAKATLTPVKTGEGKDEEKERAKP
KETISSSLLENWTKVEGLGFEGMGLSIGLRGAIRLPSFKVKRKQPPEPTSTNDNKRVRPS
TPVDDELEDEESERTDLRTDGSRTDGGGSSAKRRPARPLELDSEGEEEEETSGKEESSLS
DHEEEPVEDASERLSSGMDMEDKEDDEKKSESDSSESESSDSSDDESSSSSSSSKSDSDS
SGSESSSDYESSSGEEEEEEEEQAVAMDDEDEDDAQTSSTSSSSSSSSSEVEDVDIKAPS
TPTGPPPEEEPNELGRLEALDEAEIDHKHTAVSSIKPGVEDVWTPSPKGLPADEPDIDLA
VSIPVPKAEATLEDVSSLRPPTPTGSFADTDQDTRPKIPAEDFPRTPGRDGPVPLESEAG
IPRSLPMPSMHLPLPPSHALKARSLLPPPEALPDMPIRGRLPTEEDIPRTPGRDLMDRPR
GLGKSQSTDTVPGTPGSDTPLTGNSLSSPHIPGSPFSYPAQSPVLSAGIPRTPGRDLTFT
PAFPDSAALSAGLPMHRKASSESLEEKSLFKEPLLSASPQASLQPNNAVSSPFPGPPLPA
ASLQEPPLPPQGSSPTSVETSSPAAPKDLPVPMIDVPVPLDTTPSKRKAGRPKSKKVPVE
TPPDSEEPPAPMVASSPPDLPVNDLYPDHPSETFKREDGDSTALEEEENQTQTVIPEVED
RLSYVEEPVQKTRRQRRGWQELLLSMHSPVTSPLRPSFLPRSDFEEMTILYDIWNDGIDE
EDIRYLKITYDKMLQQDNGNDWLNDTLWVHHPPTNMGNTSGLKKKRKEDGIRDHVTGCAR
SEGYYKIDKKDKMKYLNSSRLQSEEPDVDTQGKSIPAQPQASTRAGSERRSEQRRLLSSF
SCDSDLLKFNQLKFRKKKIRFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMRE
KRYEDKGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSR
QPINVNEEITYDYKFPIEDEKIPCLCGAENCRGTLN
NT seq 5151 nt NT seq  +upstreamnt  +downstreamnt
atgtccagacctggagaaagaaataagctaaatgaagatcacggtagaagacagagttca
agtttggcgaacggaatggagaacagccatcctatctgcagttcgggagagaaacgaagt
catcattggagaagttacaagttgattattgacccagcgttgaaaaagggatcgcacaaa
ctgtatcgctacgatggacagaacttcagcctgccgaaccccggcatgccaccagtggac
aacgtccgagacccgagaatcggtcgtatgtggactaagtacaaggagactgatctcccg
gttcctaaatttaagatcgatgagtgttacatcggtcgcgtgcccccgaaggaggtcacg
ttcgccaagctcaacgacaacgtcagagagggattcctcaccgacatgtgcaagaagttc
ggcgatattgaggaggtggaaattctgtacaatccgaagaacaaaaaacatctcggaatt
gctaaagttgtattcggagccgtcaaggcggcgaaggatgctgtccagaacttgcacaac
acgtctgtcatgggcaacatcatccacgtggagttggaccctaaaggtgaacatcgccaa
aggtacttccagcgtctgatcaatggaagttatactccgctcactcttccagttggtggt
gaagaggcctgtgaagtttctccacgcagcttggctgaagccctgctgcccttgcgaaga
ctgtccgaaggcagttcttctgcagtcggaggcacggccacgccaggcggcaccaacacc
cccatgtccctggatacggcctactccagcctaaggcaggatacgccacagtcccagggt
accccacacaccccgcgtccatcgggcaccccgttctctcaggactccagctattccagc
aggcagggcactccggcgttccagtcgaaccgtgctgaatcttcgggaggctacaagtcg
agacggcatgaaaccaaattccaggatgcctacaaccgaagaccggagaggcactacgtc
cacggtacaggaggaggggcacatcgtggcaatgcagagcaaccgcccagttttaagcaa
catcagccccccgagccaccgtcgcctgcttttgcgcacacgccgccgccaccagccagt
gcaaatttcaagaatgctttctctccttatcagcccccaatgcccccagtgtaccctcac
acagagccctccttccaccaacccgttcagcgggaagtggattataggagaccgcctcaa
gccccgccacccccgagcaccgacttcatgcccgtcagagacaggcccgcaacgccgcca
atccccgagccgccaccccctgctccagaagcgggtggccatcagtcgtcaggtgaagac
atggagatttccgatgatgagatgcctggcacaccgatcgctagcggggactgtgccaaa
aacattgttgtcaactctgcgatgtctccgatgcagaccattcccatgcccccgccaggg
ttccccccactgccccatccacaggctggcttcccactgccgctgcatcctcttccaact
gtaccacacctggctggcccccatccgatgctacacccattgcacccttatccccctggc
atgatgcccattatgcagatggacctgatgagctccttaccacagtggggcagcattcac
atgtccttccagatgcaaactcagatgttaagtcgcatggcgcagagccagcggccgtac
ccttaccctcacttcatcagcggggctgctgcaagtgccggtgctgctgccgccgcagcc
atgcagtttggcagcccgtatccgcctctgtctatggttggtgcacctgcaggcactgtg
ggtcacgggcaaccctggcccttacccaacatgcccaagttcaaccctgctgttccccct
ccaggctatgagccccaaaaggaagacccacacaaagccactgtggatggagttcttatg
gttatcgtcaaggagctgaaggccatcatgaaaagagatctcaaccgaaagatggtggag
gtggtggctttcagggcatttgatgagtggtgggacaaacaggagcgttcggctaaggct
acgcttacacctgtgaagacaggtgagggcaaagatgaggaaaaagaacgggccaaaccc
aaagagactatatcctctagcttactggaaaactggaccaaggtggagggtctgggcttc
gagggaatgggactcagcataggcctgcgcggtgccatccgattaccatccttcaaggtt
aagaggaaacagccccctgagccaacatctactaatgacaataagagggtgcgaccatcc
acacctgtcgacgatgagctggaagatgaagagtcagaaagaacagatcttcgcacagac
ggttccagaacagatggtggtggttcttctgccaagcgaagaccagccagacctctggag
ctggacagcgaaggcgaggaggaggaggaaacctctggcaaagaggagtcatcgctttca
gaccatgaagaggagccagtggaagatgcctctgagaggttgtcctctggcatggatatg
gaggacaaggaagatgatgaaaagaaaagcgaatcagactccagtgagagtgaatcatcg
gactcatcggatgacgaatcttctagctcatcttcctcttccaaatctgattccgattct
tctgggagcgagagctcgtctgactacgaatcaagttcaggggaggaagaggaggaagaa
gaagagcaggcagtggcaatggatgatgaagatgaagacgatgcacaaacctcatcgacg
tcctcatcttcctcatcctcgtcttctgaagtggaggatgttgacataaaagctcctagt
acccccacaggaccaccaccagaagaggaaccaaatgagttgggcaggctggaagcgtta
gatgaagcagaaatcgatcacaaacatactgcagtgagctcaatcaagcctggagttgaa
gacgtgtggactccatctcccaaaggattgccagctgatgaacccgatattgatttggcg
gtcagtattccagtgcccaaagctgaagctaccctggaggatgttagtagcttgcggcca
cccaccccaacaggttcgtttgcagacactgatcaggacacccgaccaaagatccctgct
gaagactttccccgtacccccggtcgtgatggcccggttcccctagaatcagaggctgga
atccctcgttctcttcctatgccctcaatgcaccttcctcttccccccagtcatgccctt
aaagctcgatcccttctgccgcctcccgaagctttgccggatatgcctatccgtgggcgg
ttgcctacggaagaggacatcccacgcacaccggggagagatcttatggacagaccccgg
ggcttgggcaagtctcagagcactgatacggttcctggcacaccaggtagcgacacgccg
ctaacaggtaacagcttgagctcgccacatattcccggcagccctttctcttaccccgct
caatcccctgtcctcagcgctggtatccctcggactccgggtagagatcttactttcacc
ccagctttccctgactctgctgctttatctgcaggccttcccatgcacaggaaggcctcg
tctgagagcttggaggagaagtctctctttaaagagcctctactcagcgcctctccccag
gccagcctacagcctaacaatgcagtttcttccccattccctggtcctccccttcctgct
gcttcacttcaggaaccacctctgcctccccaaggctcctctcccacttctgttgagact
tcctctcctgctgctccaaaagaccttcctgttccaatgatagatgttcctgtgccctta
gatactactccaagcaagaggaaagcgggacgccccaagtctaaaaaggtacctgtggag
acccctccagattctgaagagcctccagctccaatggtggcctcatcacctccagatcta
ccagtaaatgatctgtacccagaccacccttcagagaccttcaaaagagaagatggtgac
tcaacagcattggaggaagaggaaaaccaaacccagacagtcatacctgaggtggaagac
aggttgtcttacgtcgaggaacctgttcagaagacgcgccgacaaaggcggggctggcaa
gagttgttgttgtccatgcactcccctgtgacatcaccgctccgccccagcttcctaccc
cgctcagattttgaggagatgaccatcttgtatgacatctggaatgacggcattgatgag
gaggacatccgctaccttaagataacttacgacaagatgctgcagcaggacaatggcaac
gactggctcaacgacaccctctgggtccaccatcctcctaccaacatgggcaacacatca
gggctgaagaaaaagcggaaagaggacggtatacgcgaccatgtcaccggctgcgcccgc
agcgagggctactacaaaatcgacaagaaagacaaaatgaagtacctgaatagctcacgc
ctgcagtctgaagagcctgatgtggacactcaggggaagagtattccagctcagccccaa
gcgtccactagggcaggttcagagcggcggtctgaacagcgccgcctgctgtcgtccttc
agctgcgacagtgacctcctcaaattcaaccagctcaagttccgtaaaaagaagatccgg
ttctgtaaaagtcacattcatgactggggattgttcgccatggaacctattgctgctgat
gagatggtaatcgaatatgtcggccagaatatccggcaggttatcgcagacatgcgagag
aagcgctacgaggataaaggcatcggcagtagctacatgttccgtgtggatcacgatacc
attatagacgcaaccaaatgtggcaacttcgcccgcttcatcaatcacagttgcaatcca
aactgttatgccaaggtcatcactgtggaatcgcagaaaaagatcgtcatctactcccgg
cagccaataaatgttaatgaggagatcacctatgactacaagttccccatcgaggacgaa
aagataccgtgcctctgtggcgcagagaactgcaggggaaccttaaactaa

DBGET integrated database retrieval system