KEGG   Serratia plymuthica S13: M621_10220Help
Entry
M621_10220        CDS       T02716                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sry  Serratia plymuthica S13
Pathway
sry00020  Citrate cycle (TCA cycle)
sry00480  Glutathione metabolism
sry01100  Metabolic pathways
sry01110  Biosynthesis of secondary metabolites
sry01120  Microbial metabolism in diverse environments
sry01130  Biosynthesis of antibiotics
sry01200  Carbon metabolism
sry01210  2-Oxocarboxylic acid metabolism
sry01230  Biosynthesis of amino acids
Module
sry_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sry_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M621_10220
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    M621_10220
Enzymes [BR:sry01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     M621_10220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AGP44135
UniProt: S4YI95
LinkDB All DBs
Position
2128928..2130181
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGKQITVDAQGKLVVPNNPIIPFIEGDGIGVDVTPAMIHVVDAAVKKAYHG
ERKISWMEIYTGEKSTHVYGKDVWLPEETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVRYYQGTPSPVKQPELTDMVIFRENAEDIYAGIEWKAGSAEADKVIKFL
RDEMGVKKIRFPEQCGIGVKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEG
AFKDWGYELAREEFGGELIDGGPWLKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGSDCALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMGWFEAADLIVKGMEGAIAAKTVTYDFERLMEGAKLLKCSEFGDAIVKHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcagaaggtaaacagattacggtcgatgcccagggt
aaactggttgttccgaataacccgatcatcccgttcatcgaaggcgacggcattggcgtt
gacgttacccctgctatgattcacgtggttgatgcggctgtgaaaaaggcctaccacggc
gaacgtaaaatctcctggatggaaatctacaccggtgaaaaatccactcacgtttacggg
aaagacgtgtggctgccggaagaaaccctggatctgatccgtgactaccgcgttgccatc
aaaggcccgctgactaccccggtcggtggcggtattcgctccctgaacgtggctctgcgc
cagcaactggacctgtacgtgtgtctgcgtccggtgcgttactaccagggcacccctagc
ccggttaaacagccagagctgaccgacatggtgatcttccgcgaaaacgccgaagacatc
tatgcgggtatcgaatggaaagccggttctgccgaagcggacaaagtgatcaagttcctg
cgcgacgaaatgggcgtgaagaaaatccgcttcccggaacaatgcggtatcggcgtcaag
ccatgttccgaagaagggaccaaacgtctggtgcgtgcggcgattgaatacgccatcacc
aacgaccgtgactctgtgaccctggttcacaaaggcaacatcatgaagttcaccgaaggt
gccttcaaggattggggctacgaactggcgcgcgaagagttcggcggcgaactgatcgac
ggcggcccgtggctgaaaatcaagaacccgaacaccggtaaagagatcgtggttaaagac
gtgatcgccgacgccttcctgcagcaaatcctgctgcgcccggcggaatacgacgtgatc
gcctgtatgaacctgaacggtgactacatctccgacgccctggccgcacaggttggcggt
atcggtatcgcacctggcgccaacatcggttccgattgcgcgctgttcgaagcgacccac
ggcaccgcacctaagtatgccggccaggacaaagtgaacccaggttccatcatcctgtcc
gcagaaatgatgctgcgtcacatgggctggttcgaagcggctgacctgatcgttaagggc
atggaaggcgcaatcgctgccaagaccgtgacctatgacttcgaacgcctgatggaaggc
gctaagctgctgaaatgttcagagtttggcgacgctatcgttaaacacatgtaa

DBGET integrated database retrieval system