KEGG   Serratia plymuthica S13: M621_11210Help
Entry
M621_11210        CDS       T02716                                 

Definition
(GenBank) glutathionine S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sry  Serratia plymuthica S13
Pathway
sry00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sry00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    M621_11210
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sry02000]
    M621_11210
Enzymes [BR:sry01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     M621_11210
Transporters [BR:sry02000]
 Other Transporters
  Pores ion channels [TC:1]
   M621_11210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_N_3 GST_C_2 GST_N_2 GST_C_6 Glutaredoxin2_C
Motif
Other DBs
NCBI-ProteinID: AGP44303
UniProt: S4YN76
LinkDB All DBs
Position
complement(2322479..2323084)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKAGACSLSPHIVLREAGLDFTAEKVDLAQKKTESGADYLAITPKGQVPALLLDDG
SLLTEGVAIVQYLADRVPDRNLIPAAGTLSRYHAIEWLNYIATELHKGFSPLFNPKTPEE
YKSIARAKLEQQFSYLDSVLAKQHFLLGNRFSVADAYLFTVLRWAIALQFDLKKHPQLAT
YFDRVAARPAVDAALNAEGLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctataaagccggtgcctgttctctgtccccacatattgtgttgcgcgag
gcaggtctggattttacggcggaaaaggtcgatctggcgcagaaaaagaccgaaagcggc
gcagactacctggcgatcactcccaaaggacaggtaccggcgctgctgctggatgatggc
agtctgctgaccgagggcgtggcgattgtgcaatatttggcggatcgcgtgcctgatcgt
aacctgatcccggcggcgggtacgctgtcgcgctatcatgccatagagtggctgaactat
attgcgaccgaattgcacaaaggatttagcccgctgtttaatccaaaaacgccggaggaa
tacaagagcatcgcacgcgccaaactggagcagcagttcagctatttggactccgtgctg
gcgaagcagcatttcctgttgggaaaccgattcagcgtggcggacgcctatctgtttacc
gttctgcgttgggccattgccttgcagtttgatctcaaaaaacacccccagttggcgacg
tattttgacagagtcgctgcgcggccagcggtggatgcggcgttgaacgccgaaggtttg
aaataa

DBGET integrated database retrieval system