KEGG   Serratia plymuthica S13: M621_13895Help
Entry
M621_13895        CDS       T02716                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sry  Serratia plymuthica S13
Pathway
sry00240  Pyrimidine metabolism
sry01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sry00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    M621_13895
Enzymes [BR:sry01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     M621_13895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 KdpD AAA_30
Motif
Other DBs
NCBI-ProteinID: AGP44756
UniProt: S4YJT2
LinkDB All DBs
Position
complement(2916305..2916889)
Genome map
AA seq 194 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDHRFGVGKVSSRIGLSSQAQ
LYNNDSMLYAMIAQEHQQQPVHCVLLDESQFLTKAQVEQLCDVVDQLDIPVLCYGLRTDF
LGELFIGSQYLLAWADKLVELKTICHCGRKANMVLRLDESGQAMHAGEQVVIGGNESYVS
VCRKHYKEAIHALE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactttatttttattattctgctatgaatgcaggaaaatccaccgcgctgtta
caatcttcatataattatcaagaacgtggtatgcgcacgttggtgtttactgccgaaatc
gatcatcgttttggcgtagggaaggtgagttcgcgcatcggattgtcgtctcaggcgcag
ctctataataatgactccatgctctatgccatgattgctcaggaacatcagcagcagccg
gtacactgcgtgttattggatgaaagccaattcttgacgaaagcacaggttgagcaattg
tgcgacgtagtcgaccaactggatattccggtgttgtgctatgggttgcgcaccgacttt
ctgggtgagctgtttatcggcagccaatatttgctggcttgggcggataaactggtggag
ttgaaaaccatctgccactgcggccgcaaggcgaatatggttctgaggctggatgaaagc
ggccaggcaatgcatgcaggtgaacaggtcgtgataggcggtaacgagagctacgtgtcc
gtttgccgcaaacattacaaggaagccatacacgcactggagtaa

DBGET integrated database retrieval system