KEGG   Serratia plymuthica S13: M621_14025Help
Entry
M621_14025        CDS       T02716                                 

Definition
(GenBank) glucose-6-phosphate 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
sry  Serratia plymuthica S13
Pathway
sry00010  Glycolysis / Gluconeogenesis
sry01100  Metabolic pathways
sry01110  Biosynthesis of secondary metabolites
sry01120  Microbial metabolism in diverse environments
sry01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M621_14025
Enzymes [BR:sry01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     M621_14025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AGP44779
UniProt: S4YJA1
LinkDB All DBs
Position
2939833..2940708
Genome map
AA seq 291 aa AA seqDB search
MNEKIFTLPVTEQISPYISQRQLEELPVVVVSHPKVRAAVALQGAHLLAWQPAGDKPVIW
LSNNTPFKKGSAIRGGVPICWPWFGPAAQPSHGFARNQPWNLTAHDEDDNGVILTFTLKD
NEQTRKLWPHAFTLIARFKLGEECEIELESHGDYQATAALHTYFQIGDIEQVKVAGLGEP
YIDKVAGGAEARQTGDLAFIGQTDRVYTQPDSFSLIKDPSLQRTIEVHHHHMSDVIAWNP
GVELSCSMADMANDGYKTMVCVETGRVSKPLVAAGEQPARLAVTFRSRKKA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaaattttcaccctgcccgttaccgaacaaatttcaccttacatcagtcaa
cgtcagctcgaagaactgccggtagtggtcgtctctcacccgaaagtccgcgccgctgtt
gcgctgcaaggcgcacacctgttagcctggcaacctgccggtgataagccggttatctgg
ctgagcaacaacaccccctttaaaaaaggcagcgccattcgcggcggtgtgcctatttgc
tggccctggtttggcccggcagcgcaaccctcgcacggtttcgcccgcaatcaaccctgg
aacctgactgcgcacgatgaagacgacaacggtgtcattctgacctttaccctgaaagac
aatgagcaaacccgcaagctttggccgcatgcctttacgctgattgcccgtttcaagctg
ggtgaagaatgcgagattgagctggagtcacacggcgactatcaggctaccgcagcgctg
catacttatttccagattggggatattgaacaagtaaaagtagcgggcctcggcgaacct
tatatcgacaaagtggccggtggagcagaagctcgtcagaccggagacctggcatttatt
ggtcaaaccgatcgggtctatacccaaccagactctttcagcctgatcaaagatccttct
ctgcaacgcaccattgaggttcatcaccatcatatgagcgatgtgattgcctggaaccca
ggcgtggagctgtcctgcagcatggcagacatggcgaatgacggttataaaaccatggtt
tgcgtggaaaccggccgtgtcagtaaaccgttggtggccgcaggcgaacaaccagcccgg
ctggcggtaaccttccgcagccgtaaaaaggcttga

DBGET integrated database retrieval system