KEGG   Serratia plymuthica S13: M621_14250Help
Entry
M621_14250        CDS       T02716                                 

Definition
(GenBank) adenylate cyclase
Organism
sry  Serratia plymuthica S13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_8 LRR_4
Motif
Other DBs
NCBI-ProteinID: AGP44820
UniProt: S4YK78
LinkDB All DBs
Position
2987016..2987900
Genome map
AA seq 294 aa AA seqDB search
MLHQHPQQNSSSLALDLDGQGLESLDDDRLQGSALLKISLYGNRLRQFPAQIFQHRALQV
LNISCNQLSELPEELGQWQKLAMLDCGHNKAERVPASIGQLSELTYLYLSDNAFSTLPIE
LGRLHKLRYLNVTDNLLSELPAAIVQLSGLLELRLYNNQITALPAAIGQLSALQELHLMN
NRLETLPEEISQLSELAVLDVENNAISRLPAAFCHLASLTDLNLRANQLRQLPGCFGQLT
ALTTLDLRANRLSELPDSMAALTRLRRLDLRWNNFAQMPAVLEPLMAQGCMVHI
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcttcatcaacacccacagcaaaacagcagttcgcttgcattggatcttgacggccag
gggctggaaagcctggacgatgaccgcctgcagggcagcgcattgctgaaaatcagcctg
tacggcaatcgcctccgccagtttccggcgcagatctttcagcatcgtgcgctgcaggta
ctgaatatctcctgcaaccaactcagtgaactgccggaagagctcggccaatggcaaaaa
ctggcgatgctggattgcggtcacaacaaagccgagcgcgtgcctgccagcatcggccaa
ctcagcgaactgacctatctttatctgagcgacaacgctttcagcacgctccccatagag
ctgggccgtttgcataaattgcgctatctaaacgtgaccgataacctactgagcgaactg
ccggctgctatcgttcaattgagcggcctgctggaactgaggctgtataacaaccagatt
accgcgttgccggccgccatcggccagttgagcgcgctgcaggaactgcacctgatgaat
aatcgtctggaaacgctgccggaagagatctcgcaattgtctgaactggcggtgctggac
gtggaaaataacgccatcagcaggctgcctgcggcattctgccacttagccagcctgacc
gacctcaatctgcgcgctaatcagctacggcagctgccaggctgtttcggtcaactaacg
gcgctcaccacgcttgacctgcgcgctaaccggttgagtgagctgccggacagcatggcg
gcattgactcgtctgcggcgattagatttgcgctggaacaacttcgcccaaatgcctgcg
gtactggaaccattgatggcgcaaggctgtatggtgcatatataa

DBGET integrated database retrieval system