KEGG   Serratia plymuthica S13: M621_20115Help
Entry
M621_20115        CDS       T02716                                 

Definition
(GenBank) hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
sry  Serratia plymuthica S13
Pathway
sry00061  Fatty acid biosynthesis
sry00780  Biotin metabolism
sry01100  Metabolic pathways
sry01212  Fatty acid metabolism
Module
sry_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sry00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    M621_20115
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    M621_20115
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sry01004]
    M621_20115
Enzymes [BR:sry01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     M621_20115
Lipid biosynthesis proteins [BR:sry01004]
 Fatty acid synthase
  Component type
   M621_20115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: AGP45754
UniProt: S4YLZ0
LinkDB All DBs
Position
complement(4235319..4235774)
Genome map
AA seq 151 aa AA seqDB search
MTTDTHTLDIAEILELLPHRYPFLLVDRVLEFEEHKFLRAVKNVSVNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVATVDGKIVCEATMMCARSRES
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgacactcatactctggatattgcagaaattttggagttgcttcctcaccgt
tacccgttcttgctggtcgatcgcgtccttgagtttgaggagcacaaattcctgcgtgcg
gtgaagaacgtatctgtaaatgagccgtttttccaggggcacttccctggtaagccgatt
tttccaggcgtattgattctggaagcaatggcgcaggctaccggtattctggcgtttaaa
agcgtcggcaaactggagccgggcgaattgtattactttgccggtatcgacgaagcccgt
ttcaaacgaccggtagtgccaggcgatcagatgatcatggaagtcacctttgagaaaact
cgtcgtggtctgacgcgcttcaaaggcgtagcgaccgttgacggcaaaattgtttgcgaa
gcaaccatgatgtgtgcgcgcagccgggagtcttaa

DBGET integrated database retrieval system