Serratia plymuthica S13: M621_20520 Help Entry M621_20520        CDS       T02716                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sry  Serratia plymuthica S13 Pathway sry00998   Biosynthesis of various antibiotics sry01100   Metabolic pathways sry01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sry00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M621_20520   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M621_20520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGP45824 UniProt:  S4YM54 LinkDB All DBs Position complement(4326304..4326549) Genome browser AA seq 81 aa AA seqDB search MMEKYQILHEAVCTLLYEARELDRASLSADIPLRQLGLDSLDYVELMLLAKREFGISLSA EMFIDQPDLTLSELCHYMSSQ NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgatggaaaagtaccaaatcttgcatgaagctgtttgcaccctgctatacgaggccagg gagttggatcgggcatccctgtcggcagatatacctttgcggcagttaggcttggatagc ctggattatgtggagttgatgctgctggccaagcgagagttcgggatatcactcagtgcg gagatgtttattgaccagccggatctgacattatcagagctctgtcattatatgtcctcg caataa

DBGET integrated database retrieval system