KEGG   Serratia rubidaea: AXX16_0488Help
Entry
AXX16_0488        CDS       T04417                                 

Definition
(GenBank) Manganese superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
srz  Serratia rubidaea
Brite
Enzymes [BR:srz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AXX16_0488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Arabino_trans_C
Motif
Other DBs
NCBI-ProteinID: AML56227
UniProt: A0A126VDI9
LinkDB All DBs
Position
529398..530027
Genome map
AA seq 209 aa AA seqDB search
MIMSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLEAYPELASLSVEELI
KDLDKVPADKRTFMRNNAGGHANHSFFWKNLKTGTTLSGDLKAAIERDFGSVEKFQEEFE
KAAATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVAGASGFPLIGLDVWEHAYYLK
YQNKRPDYIKAFWNVVNWDEAAARFAAKK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgagttattcactgccatcactgccgtacgcctatgacgcgctggaaccgcac
tttgacaagcagacgatggagatccatcacaccaaacaccatcagacctacgtcaacaac
gccaacaccgtgctggaagcctacccggaactggcgtcgctgagcgttgaagagctgatc
aaagacctggataaggttccggccgacaagcgcacctttatgcgcaacaacgccggcggc
cacgccaaccacagcttcttctggaaaaacctgaaaaccggcaccaccctgtccggcgat
ctgaaggccgccatcgagcgcgacttcggcagcgtggagaaattccaggaagagttcgag
aaagccgccgctacccgtttcggttccggctgggcatggctggtgctgaaagatgacggc
aaactggccgtagtctccaccgccaaccaggacagcccgctgatgggcgaagccgttgcc
ggcgcctccgggttcccgctgatcggcctggacgtgtgggagcacgcttactacctgaaa
tatcagaacaaacgcccggactacatcaaagcattctggaacgtggtgaactgggacgaa
gccgccgcgcgcttcgccgccaagaagtaa

DBGET integrated database retrieval system