KEGG   Serratia rubidaea: AXX16_0772Help
Entry
AXX16_0772        CDS       T04417                                 

Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
srz  Serratia rubidaea
Pathway
srz00564  Glycerophospholipid metabolism
srz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AXX16_0772
Enzymes [BR:srz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AXX16_0772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 3HCDH_N FAD_oxidored Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AML56500
UniProt: A0A126VDZ8
LinkDB All DBs
Position
complement(843985..845493)
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPGS
KSLRFGPESVLKPELKRGFEYSDCWVDDARLVVLNAQEVVERGGEVRTRTKVTRAWRENG
MWMVEATDIDSGKTFTWRAKGLVNATGPWVKNFFDDGLKLKSPYGIRLIKGSHIVVPKAH
NQPQSYILQNEDNRIVFVIPWMDEFSIIGTTDVEYHGDPKDVKIDDNEINYLLKVYNDHF
KKQYGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDVHDDNGQAPLLSVFGGKLTTYRK
LAEHAMEKLARYYPEAGPAWTKNGTLPGGDIGGDRDSYAAKLRREHGWLPEALARRYART
YGSHSELILSGANSLADLGEDFGHGLYEAELRYLVEKEWVVELKDAIWRRTKLGMWLDEA
QQARVSEWLAERAKAKALSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacttgatcgttatcggtggcggcatcaacggtgccggcatcgcggcg
gatgctgccgggcgcgggctgtccgtactgctactggaagcgcaagacttggcctgtgct
acgtcttccgccagttccaaactgatccacggcggcctgcgctacctggaacactacgaa
ttccgtctggtcagcgaagcgctggcggaacgtgaagtgctgctgaaactggcgccgcat
atcgccttcccgatgcgcttccgcctgccgcaccagccgcacctgcgtccggcttggatg
atccgcaccggcctgttcctgtacgatcacctgggcaagcgcaccagcctgccgggcagc
aagagtttgcgttttggcccagaatccgttctgaagccggaactgaagcgcggtttcgaa
tattccgactgctgggttgacgatgcgcgtctggtggtactgaacgcgcaggaagtggtg
gaacgcggcggcgaagtgcgcacccgcaccaaagtgacccgcgcatggcgtgaaaacggc
atgtggatggtggaagcgaccgatatcgacagcggcaaaaccttcacctggcgcgccaaa
ggtctggtcaacgccaccggcccgtgggtgaaaaacttcttcgacgacggcctcaagctg
aaatccccgtacggcatccgcctgatcaaaggcagccatatcgtggtgccgaaggcgcat
aaccagccgcagtcgtacattctgcagaacgaagacaaccgtatcgtcttcgtaatcccg
tggatggatgagttctcgattatcggcaccaccgacgtggagtatcacggcgatccgaaa
gacgtgaaaattgacgataacgaaatcaactacctgctgaaagtgtacaacgaccacttt
aagaagcagtacggccgcgacgatatcgtctggacctactccggcgtgcgtccgctgtgt
gacgatgagtccgactcaccgcaggccatcacccgtgactacacgctggacgtgcacgac
gacaacggccaggcgccgctgctgtcggtcttcggcggtaagctgaccacctaccgcaag
ctggcggaacacgcgatggaaaaactggcgcgttattatccggaagccggccctgcctgg
accaaaaacggcaccctgccgggcggcgacatcggcggcgaccgcgacagctacgctgcc
aaactgcgccgtgaacacggctggctgccggaagcactggcgcgtcgctatgcccgtacc
tacggcagccacagcgagctgatcctgtccggcgccaacagcctggcggatctgggcgaa
gacttcggtcacggcctgtacgaagcggagctgcgctacctggtggagaaagagtgggtg
gtggagctgaaagacgctatctggcgccgcaccaagctcggcatgtggctggacgaggcg
cagcaggcgcgcgtcagcgagtggctggcggaacgcgcaaaagccaaagcgctgtcgctg
gcttcctaa

DBGET integrated database retrieval system