KEGG   Serratia rubidaea: AXX16_0984Help
Entry
AXX16_0984        CDS       T04417                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
srz  Serratia rubidaea
Pathway
srz00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:srz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AXX16_0984
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:srz02000]
    AXX16_0984
Enzymes [BR:srz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AXX16_0984
Transporters [BR:srz02000]
 Other Transporters
  Pores ion channels [TC:1]
   AXX16_0984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AML56706
UniProt: A0A126VFS0
LinkDB All DBs
Position
1067574..1068242
Genome map
AA seq 222 aa AA seqDB search
MITVHHLNNSRSQPILWFLEELAVPYQVQRYQREAGSLLAPPALKKIHPLGKSPVIVDGD
LTLAESGAIIEYLQEAYDAQGLFIPTDFHARQQYRYWLHYAEGSLMPLLVMKLVFGRLGQ
PPVPLLLRKVAGAVGKGVQRNYLDKQIAVHRDYLERHLRSNPWFAGHDFSAADIKMSFPL
EAMAARSGLDGCPQLRDFLRRIHQRPAYQRALEQGGPYHLLL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgttcaccacctgaataactcgcgctcgcagcctatcttatggtttttggaa
gagctggcggtgccttatcaggtgcagcgctatcagcgggaggcggggagcctgctggcg
ccgccggcgttgaagaaaatccacccgctgggcaaatcgccggtaattgttgacggcgat
ttgacgctggccgagtccggcgcaatcatcgagtatctgcaggaagcctatgatgcgcag
gggctgtttatccccaccgattttcatgcgcgtcagcagtaccgctactggctgcactat
gcggaaggttcgctgatgccgctgctggtgatgaagctggtgtttggccgccttgggcaa
ccgccggtgccgctgctgctgcgcaaggtggccggcgccgtcggtaaaggagtgcagcgc
aactatctcgataagcagatcgccgtgcatcgcgactatctggaacgacacctgcggagc
aacccctggtttgccggccatgacttcagcgccgccgatatcaaaatgagctttccgctg
gaggcgatggccgcgcgcagcgggctggacggctgcccgcagctgcgcgattttctgcgg
cgcattcatcagcgcccggcttaccagcgtgcgctggagcagggcggcccttatcatctg
ctgctctag

DBGET integrated database retrieval system