KEGG   Serratia rubidaea: AXX16_1230Help
Entry
AXX16_1230        CDS       T04417                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
srz  Serratia rubidaea
Pathway
srz00061  Fatty acid biosynthesis
srz00780  Biotin metabolism
srz01100  Metabolic pathways
srz01212  Fatty acid metabolism
Module
srz_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:srz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AXX16_1230
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AXX16_1230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:srz01004]
    AXX16_1230
Enzymes [BR:srz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     AXX16_1230
Lipid biosynthesis proteins [BR:srz01004]
 Fatty acid synthase
  Component type
   AXX16_1230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA AfsA 4HBT
Motif
Other DBs
NCBI-ProteinID: AML56951
LinkDB All DBs
Position
1326481..1326924
Genome map
AA seq 147 aa AA seqDB search
MTEPIRPAAIARVLPHRYPFQLIDLVLSDPHEMAQGRVRALKNISANDTLLQGGALTAGR
FPSVLLLEALAQAAGMLVHHRLTLLEAGQPCYFAAIRRAHFYAAARAGDCLHLDVRLLRQ
RRNMVRFSGVATVAGKRLCVAEFTCAS
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaccgatccgcccggcggcgattgcccgggttttaccgcatcgttaccccttt
caactgatcgatctggtgctgtcggacccgcatgaaatggcgcagggacgggtgagagcg
ctgaaaaatatcagcgccaacgataccttgctgcagggcggcgcgctgaccgcgggccgt
tttccttccgtattgctgctggaggcgctggcgcaggcggcggggatgctggttcatcat
cgcctgacgctgctggaagcggggcagccctgctatttcgccgcgatccggcgcgcgcat
ttttacgcggcggcccgggcgggcgattgcctgcatttggatgtgcgtctgctgcgccag
cgccgcaatatggtgcgcttttccggcgtggcgacggtggcggggaaacgtctctgcgtg
gctgaatttacctgcgccagctga

DBGET integrated database retrieval system