KEGG   Serratia rubidaea: AXX16_1811Help
Entry
AXX16_1811        CDS       T04417                                 

Definition
(GenBank) Sorbitol dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
srz  Serratia rubidaea
Brite
KEGG Orthology (KO) [BR:srz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AXX16_1811
Enzymes [BR:srz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     AXX16_1811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N FAM72
Motif
Other DBs
NCBI-ProteinID: AML57524
UniProt: A0A126VGT9
LinkDB All DBs
Position
1957156..1958268
Genome map
AA seq 370 aa AA seqDB search
MCQTCVTAAKMADGIPETMKAIVAYAPKDYRLEEVAVPKIGPKEILVKIEACGICAGDIK
AFEGAPSFWGDETQPAYIKAPMIPGHEFIGHVVGYGEGVEGFEIGDRVISEQIVPCWQCR
FCNRGQYWMCEKHDLYGFQKNVNGGMAEYMKFTKEAINYHVPADLPIEKAILIEPYACSF
HAVQRANIKLGDVVVLAGAGTLGLGMIGAIKKSGPSKLIVLDLSDDRLALAKTFGADLTL
NPTRDDVPAIVKQLTDGYGCDIYIEATGAQKSVEQGLTLIRKLGTFVEFSVFKDPVTVDW
SIISDRKELDVLGSHLGPYCYPLVIEGIHNGDLPTEGVVTHTLPLEQFAEGFELMKRGIG
SIKVVLNPNL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcagacctgtgtaacagcggcaaaaatggcggacggcatcccagaaaccatgaag
gcgatcgttgcctacgcgccaaaggattaccgtctggaagaggtggcggtaccgaagatc
ggcccgaaagagatcctggtgaagatcgaggcctgcggcatctgcgccggcgatatcaag
gcgtttgaaggcgcgccgagcttctggggcgatgagacgcagccggcctatatcaaggcg
ccgatgatcccggggcatgaatttatcggccacgtggtcggctacggagagggcgtggaa
gggtttgagatcggcgaccgggtgatctccgagcagatcgtcccctgttggcagtgtcgt
ttctgcaaccgcggccagtactggatgtgtgaaaaacacgatctgtacggcttccagaag
aacgttaacggcggcatggccgaatacatgaagttcaccaaagaggcgattaactaccac
gtaccggcggatctgccgattgaaaaagccattctgatcgaaccttacgcctgttcgttc
catgcggtgcagcgcgccaatatcaaactgggggacgtggtggtgctggcgggggccggt
acgctgggcctggggatgatcggcgcgatcaaaaaatccgggccgtcgaagctgatcgtg
ctcgatctgtcggatgaccggctggcgctggcgaagaccttcggcgcggatctgacgctc
aatcctacccgcgacgacgtaccggcgatcgtcaaacagctgaccgacggctacggctgc
gatatctacattgaagccaccggcgcgcagaagtcggtggagcaggggctgacgctgatc
cgcaagctcggcaccttcgtggagttctcggtgttcaaggatccggtgaccgttgactgg
agcatcatcagcgaccgcaaagagctggacgtgctcggctctcaccttggcccgtactgc
tatccgctggtgattgagggcatccacaacggcgatttgccgaccgaaggggtggtgacc
cacaccctgccgctggagcagttcgccgaaggtttcgagctgatgaaacgcggcatcggg
tcgatcaaagtggtgcttaatccaaacctgtaa

DBGET integrated database retrieval system