KEGG   Serratia rubidaea: AXX16_2651Help
Entry
AXX16_2651        CDS       T04417                                 

Definition
(GenBank) Aldose 1-epimerase family protein YeaD
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
srz  Serratia rubidaea
Pathway
srz00010  Glycolysis / Gluconeogenesis
srz01100  Metabolic pathways
srz01110  Biosynthesis of secondary metabolites
srz01120  Microbial metabolism in diverse environments
srz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:srz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXX16_2651
Enzymes [BR:srz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     AXX16_2651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AML58350
UniProt: A0A126VJ58
LinkDB All DBs
Position
complement(2856314..2857189)
Genome map
AA seq 291 aa AA seqDB search
MNEKVFTLPISKQISPYISQRQLDELSVVVVSHPKVRAAVTLQGAHLISWQPSGERPVIW
LSDNTPFKTGSAIRGGVPICWPWFGPAGKPSHGFARNQPWRLTAHDEDQDGVILTFTLQD
NEQTRKLWPHAFMLIARFKLGESCEIELESHGDYQATAALHSYFQIGDIARVSVAGLGET
YLDKVANAAEARQSGEVTFSGQTDRIYTQPAACSLIKDPALQRTIEVQHHHMSDVIAWNP
GAELSCSMADMANDGYKTMVCVETGRLSKPLLAQGEQPARLGVTFRCRKGA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaagttttcaccctgcccatcagcaagcagatctccccgtatatcagccag
cggcagctggacgaactgagcgtggtggtggtgtctcaccccaaagtccgcgcggcggtg
acgctgcagggcgcgcatttaatcagctggcagccgagcggcgaacggcccgtcatctgg
ctgagcgataacaccccgtttaaaaccggcagcgccatccgcggcggcgtccccatctgc
tggccatggttcggcccggccggcaaaccgtcgcacggctttgcacgtaaccaaccctgg
cggctgaccgcccacgacgaagaccaggacggcgttatcctcacctttacgctgcaggat
aacgaacagacccgcaagctgtggccgcacgctttcatgctgatcgcccgcttcaagctc
ggggaaagttgtgagatcgagctggaatcacacggcgactatcaggccaccgcggcgctg
cacagctatttccaaatcggcgatatcgccagggtcagcgttgccgggctcggagagacg
tatctggataaggtggccaacgccgccgaggcccgccagagcggcgaggtgaccttcagc
ggccagaccgaccgcatttacacccagccggcggcctgcagcctgatcaaggatccggcg
ctgcagcgcacgattgaagtgcagcaccaccatatgagcgatgtgatcgcctggaacccg
ggggcggagctatcctgcagcatggcggatatggccaacgacggctacaagaccatggtg
tgcgttgaaaccgggcggctcagcaagccgctgctggcgcagggcgaacagccggcccgt
ctgggggtcaccttccgctgccgcaaaggcgcctga

DBGET integrated database retrieval system