KEGG   Serratia rubidaea: AXX16_3055
Entry
AXX16_3055        CDS       T04417                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
srz  Serratia rubidaea
Pathway
srz00480  Glutathione metabolism
srz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AXX16_3055
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:srz02000]
    AXX16_3055
Enzymes [BR:srz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AXX16_3055
Transporters [BR:srz02000]
 Other transporters
  Pores ion channels [TC:1]
   AXX16_3055
SSDB
Motif
Pfam: GST_C GST_C_2 GST_C_3 GST_N GST_N_2 GST_N_3 GST_C_6 Glutaredoxin2_C GST_N_5
Other DBs
NCBI-ProteinID: AML58752
UniProt: A0A4U9HH01
LinkDB
Position
3284354..3284959
AA seq 201 aa
MKLFYKAGACSLSPHIVLREAGLDFTAEKVDLANKTTESGADYLTINPKGQVPALLLDDG
SLLTEGVAIVQYLADRVPDRQLIPPAGTLSRYHAIEWLNFVASDLHKGFSPLFNPKTPEE
YLAIARAKLEQHFRYLDDTLAQRHYLLGSRFSVADAYLFTVLRWAVALQFDLQRYPNLAG
YMKRVAARPAVAAALNAEGLQ
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaaactgttctataaagccggcgcctgttccctgtccccgcatatcgtactgcgcgag
gcggggctggatttcaccgcggaaaaagtcgatctggccaacaaaaccaccgagagcggt
gccgactatctgacgattaaccccaaaggacaggttccggcgctgctgctggacgacggc
agcctgctgaccgaaggcgtggcgatagtgcagtatctggcggatcgggtgcccgaccgt
cagctgatcccgccggcgggcacgctgtcgcgctaccacgcgattgaatggctgaacttt
gtcgcctccgatctgcacaagggctttagcccgctgtttaatccgaaaacgccggaagag
tatctggcgattgcgcgcgccaaactggagcagcatttccgctatcttgacgacacgctg
gcgcagcggcactacctgctgggcagccgcttcagcgtcgcggacgcctacctgtttacc
gtactgcgctgggcggtggcgctgcagttcgatctgcagcgctatccaaacctggccggc
tatatgaaacgggtggcggcgcgtccggcggtggccgccgcgctgaatgccgaagggttg
cagtaa

DBGET integrated database retrieval system