KEGG   Serratia rubidaea: AXX16_3079Help
Entry
AXX16_3079        CDS       T04417                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
srz  Serratia rubidaea
Brite
Enzymes [BR:srz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AXX16_3079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AML58776
UniProt: A0A126VLR3
LinkDB All DBs
Position
3307128..3307742
Genome map
AA seq 204 aa AA seqDB search
MGIWRYINKEKAMSFELPALPYAKDALEPHISAETLEYHYGKHHNTYVVNLNNLVKGSEF
EGKTLEEIVKTSTGGVFNNAAQVWNHTFYWHCLSPQGGGEPTGAVADAINQSFGSFAKFK
EEFTKSAVGNFGAGWTWLVKKADGSLAIVNTSNAATPLTGDDKPLLTVDVWEHAYYIDYR
NARPNYLENFWALVNWAFVAENLA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgggcatctggcgctatatcaataaggagaaagcaatgtcgtttgaattacctgcatta
ccgtacgccaaagacgctctcgaaccgcacatttccgctgaaacgctggaataccactac
ggcaagcaccacaatacctacgtggtaaacctgaacaacctggtgaaaggcagcgagttc
gaaggcaaaaccctggaagagatcgtgaaaacctctaccggcggcgtgttcaacaacgcg
gcgcaggtgtggaaccacaccttctactggcactgcctgtcgcctcagggcggcggtgaa
cctaccggcgcggtggctgacgccatcaaccagtccttcggctctttcgccaagttcaaa
gaagagttcaccaaatccgccgtcggcaacttcggcgccggctggacctggctggtgaaa
aaggccgacggctcgctggcgatcgtcaacacctccaacgcggctaccccgctgactggt
gacgacaaaccgctgctgaccgtggacgtgtgggaacacgcttactacatcgattaccgc
aatgcgcgtcctaactacctggaaaacttctgggcgttggtgaactgggcattcgtggcg
gaaaacctggcgtaa

DBGET integrated database retrieval system