KEGG   Serratia rubidaea: AXX16_3447
Entry
AXX16_3447        CDS       T04417                                 

Definition
(GenBank) 23S rRNA (guanine-N-2-)-methyltransferase rlmL
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
srz  Serratia rubidaea
Brite
KEGG Orthology (KO) [BR:srz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:srz03009]
    AXX16_3447
Enzymes [BR:srz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     AXX16_3447
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     AXX16_3447
Ribosome biogenesis [BR:srz03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AXX16_3447
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_31 Methyltransf_25 MTS Methyltransf_11 Methyltransf_15 Methyltransf_24 N6_Mtase
Other DBs
NCBI-ProteinID: AML59138
LinkDB
Position
complement(3707047..3709203)
AA seq 718 aa
MRNNFLFGDKYDMNSLFASTARGLEELLKSELERLGAHACKVVQGGVHFQGDDRLLYQSL
LWSRLASRILLPLNEFRVHSDLDLYLGVQAIDWTSIFGVDKTFAVHFSGVNEEIRNSQYG
ALKVKDAIVDSFTRKIDQRPTVAKQQPDIRINVFLQRDMASVALDLSGEGLHQRGYRDLT
GQAPLKETLAAAIVQRSGWQPGTPMLDPMCGSGTLLIEAAMIAADRAPGLHRQHWGFSAW
NGHNAELWREVVTEAQVRARRGLQETTSRFFGSDIDRRVIDMARANARRAGVAELITFNV
NDVSKLSNPLPEGPTGTVLSNPPYGERLESEPALIALHNMLGRIMKSAFGGWQLSLFSAS
PSLLSCLQLRAERQYKAKNGPLDCVQKNYQLAENPQGSGGIQVAEDFANRLRKNVKKLDK
WAKQQGIECYRLYDADLPEYNVAVDRYGSKVVVQEYAPPKTVDAQKARQRLFDVINATLA
VLELPSNQLVLKTRERQKGKNQYEKLAQKGEFLLVEEFNAKLWVNLTDYLDTGLFLDHRI
ARRMLGEMSKGKDFLNLFAYTGSASVHAGLGGARSTTTVDMSRTYLEWAEKNLRANGLTG
RQHRLIQADCLSWLHNAAEQFDVIFIDPPTFSNSKRMENTFDVQRDHLALMTDLKRLLRR
NGTIMFSNNKRGFRMDLDGLKALGLEAKEITNQTLSQDFARNRQIHNCWLVSHAGEGK
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgcgcaacaattttctttttggtgataagtacgatatgaactctttgtttgctagcaca
gcgcgtggattggaagaactgttaaaaagcgaactggagcggcttggcgcccacgcctgt
aaagtcgtgcagggcggggtacattttcaaggcgacgatcgtcttctgtaccaaagtctg
ctgtggagccgcctggcttcacgcattttgctgccgctgaatgaattccgcgtgcacagc
gatctggatctctaccttggcgtgcaggcgatcgactggacgtcgattttcggcgtggat
aaaaccttcgccgtgcacttcagcggcgtgaacgaagagattcgcaacagccagtacggc
gcgttgaaagtgaaagacgccatcgtcgacagctttacccgcaaaatagaccagcgcccg
accgtggcgaaacagcagccggatatccgcatcaacgtcttcctgcagcgcgatatggcc
agcgtggcgctcgacctgagcggcgagggcctgcaccagcgcggctaccgcgatctgacc
ggccaggcgccgctgaaagagactctggcggcggcgatcgtacagcgctccggctggcag
cctggcacgccgatgctggatccgatgtgcgggtccggtaccttactgattgaagcggcg
atgatcgccgccgatcgcgcgccggggctgcatcgccagcactggggcttcagcgcctgg
aacggccacaacgccgagctgtggcgtgaagtggtgaccgaagcgcaggtgcgcgcccgc
cgcgggctgcaggaaaccacctcgcgtttcttcggctcggatatcgaccgccgggtgatt
gatatggcgcgcgccaacgcccgccgcgccggcgtcgccgaactgattacctttaacgtc
aatgacgtcagcaagctgagcaatccgctgccggaaggcccgacgggcaccgtactcagc
aacccgccgtatggcgaacgcctggaaagcgaaccggcgctgattgcgctgcacaacatg
ctggggcgcattatgaagagcgcgttcggcggctggcagctgtcgctgttcagcgcttcg
ccgtcgctgctgagctgcctgcagctgcgcgccgagcgccagtataaggccaaaaacggc
ccgctggactgcgtacagaaaaactatcagctggcggaaaacccgcagggcagcggcggc
attcaggtggcggaagatttcgccaaccggctgcgtaagaacgttaaaaagctggataag
tgggcgaagcagcaggggattgagtgctatcgcctgtatgacgccgacctgccggagtat
aacgttgcggtggatcgctacggcagcaaagtggtggtgcaggagtacgcgccgccgaaa
acggtcgatgcgcaaaaggcgcgtcagcggctgtttgacgtgatcaacgccacgctggcg
gtgctggagctgccgtccaaccagctggtgctgaagacccgcgagcggcagaaggggaaa
aaccagtatgagaaactggcgcagaagggcgagttcctgctggtggaagagtttaacgcc
aagctgtgggttaacctgaccgactacctggataccggcctgttcctggatcaccgcatc
gcgcgccgtatgctgggcgagatgagcaaagggaaagattttctcaacctgttcgcctat
accggcagcgccagcgtgcacgccggcctgggcggcgcgcgctccaccaccacggtcgat
atgtcgcgcacctatctggaatgggcggagaaaaacctgcgcgccaacggtctgaccggg
cggcagcaccgattgatacaggcggattgcctgtcatggctgcataatgccgccgaacag
ttcgacgtgatctttatcgatccgccgaccttctccaactccaagcggatggagaacacc
tttgacgtgcagcgcgaccatctggcgctgatgacggatttaaaacggctgctgcgccgt
aacggcaccattatgttctcgaacaacaagcgcggtttccgcatggatctcgatgggctg
aaggccctgggtctggaagcgaaagagatcaccaatcagacgctgtcgcaggactttgcc
cgtaaccgtcagattcacaactgctggctggtcagccatgccggcgaaggaaagtaa

DBGET integrated database retrieval system