KEGG   Serratia rubidaea: AXX16_3810Help
Entry
AXX16_3810        CDS       T04417                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
srz  Serratia rubidaea
Pathway
srz00473  D-Alanine metabolism
srz00550  Peptidoglycan biosynthesis
srz01100  Metabolic pathways
srz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:srz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AXX16_3810
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AXX16_3810
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AXX16_3810
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:srz01011]
    AXX16_3810
Enzymes [BR:srz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AXX16_3810
Peptidoglycan biosynthesis and degradation proteins [BR:srz01011]
 Precursor biosynthesis
  Amino acid ligase
   AXX16_3810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST RimK ATP-grasp_3 GARS_A RHH_5
Motif
Other DBs
NCBI-ProteinID: AML59501
UniProt: A0A448S0B5
LinkDB All DBs
Position
complement(4116116..4117222)
Genome map
AA seq 368 aa AA seqDB search
MTKRRVGVIFGGKSAEHEVSLQSAKNIVDAIDKEKFDVTLLGIDKQGQWHINDASNYLLH
AENPALIALNHSNKNVALVPGQESSQLIEADSANVIGQLDVVFPIVHGTLGEDGSLQGLL
RMANIPFVGAGVLGSAVSMDKDVTKRLLRDAGLEVAPFVTLTRSNRAQHSFEQLSAQLGS
PLFIKPANQGSSVGVSRVSDPAGYEQAVALAFSFDHKVLVESAIVGREIECAVLGNDQPQ
ASLCGEIVLSDEFYSYDTKYINEQGAQVVVPAAISEQASDKVRDVALRAFRALDCLGMAR
VDVFLTEDERVIVNEINTLPGFTNISMYPKLWAASGMSYSQLITTLIELALERHQQDRAL
HSSVFDRD
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgactaaacgacgtgttggcgtaatttttggtggtaaatcggcggagcatgaggtttcg
ctgcagtcggcaaaaaacattgtcgatgccatcgacaaagagaagtttgacgtcacgctg
ctgggcatcgacaagcaggggcagtggcatattaacgatgcctccaactacctgctgcat
gcggaaaacccggcgctgatcgccctgaaccactcgaataaaaacgtggcgctggtgccg
gggcaggagagcagccaactgattgaggccgacagcgccaacgttatcggccagctcgac
gtggtgttcccgatcgtacacggcacgctgggggaggacggttcgctgcaggggctgctg
cggatggcgaacatcccgtttgtcggcgccggcgtgctcggctcggcggtcagcatggat
aaagacgtcaccaaacgcctgctgcgcgacgccgggctggaggtggcgccgttcgtcacc
ctgacgcgcagcaaccgcgcgcagcacagttttgagcagctgagcgcgcagctggggtcg
ccgctgtttatcaagccggccaaccagggttcctccgtcggcgtcagccgggtcagcgac
ccggcaggctatgagcaggcggtggcgctggcgttcagcttcgaccacaaggtgctggtg
gagtcggcgattgtcggccgtgagattgagtgcgcggtgctgggcaacgaccagccgcag
gccagcctgtgcggggaaatcgtgctgagcgacgaattctactcctacgacaccaaatac
attaacgagcagggcgctcaggtggtggtgccggcggcgatctccgagcaggccagcgat
aaggtgcgcgacgtcgcgctgcgggcgttccgcgcgctggactgcctgggcatggcgcgc
gtcgacgtgttcctcaccgaggatgagcgggtgatcgtcaacgaaatcaacacgctgccc
ggctttaccaatatcagcatgtatccgaagctgtgggcggccagcggcatgagctacagc
cagctgatcaccaccctgatcgaactggcgctggagcgtcaccagcaggaccgtgcgctg
cacagttcggtgttcgatcgcgactaa

DBGET integrated database retrieval system