KEGG   Serratia rubidaea: AXX16_4386Help
Entry
AXX16_4386        CDS       T04417                                 

Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
srz  Serratia rubidaea
Pathway
srz00473  D-Alanine metabolism
srz00550  Peptidoglycan biosynthesis
srz01100  Metabolic pathways
srz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:srz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AXX16_4386
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AXX16_4386
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AXX16_4386
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:srz01011]
    AXX16_4386
Enzymes [BR:srz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AXX16_4386
Peptidoglycan biosynthesis and degradation proteins [BR:srz01011]
 Precursor biosynthesis
  Amino acid ligase
   AXX16_4386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 ATPgrasp_Ter ATP-grasp RimK TTL ATPgrasp_ST ATPgrasp_YheCD GARS_A
Motif
Other DBs
NCBI-ProteinID: AML60056
UniProt: A0A140F152
LinkDB All DBs
Position
complement(4701016..4701936)
Genome map
AA seq 306 aa AA seqDB search
MTDKVAVLLGGTSAEREVSLQSGAAVLAGLREAGIDAHGIDTRDVPVSQLKAQGFSKVFI
ALHGRGGEDGTLQGMLEFLELPYTGSGVMASALTMDKWRTKLVWQSLGLPIAPYVALHRA
QFNGAGKHQALADIEALGLPLIVKPSREGSSVGMSKVEAFGALEAALDEAFRHDDDVLVE
KWLSGPEYTVAFIGDSVMPSIRIQPAGVFYDYQAKYIADDTQYFCPSGLSAEQEAELAAL
AVRAYRALDCSGWGRVDVMQDNDGSFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVAR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgactgataaagtcgccgtcctgctgggcggcacctcggcggaacgtgaagtttccctg
cagtccggcgcggcggtgctggccggcctgcgcgaagccggtatcgacgcgcacggcatc
gatacccgcgatgtcccggtgtcgcagctgaaggcgcaggggttcagcaaagtgtttatc
gcgctgcacgggcgcggcggcgaggacggcaccctgcaggggatgctggagttcctggag
ctgccctataccggcagcggcgtaatggcctcggcgctgaccatggacaaatggcgcacc
aaactggtgtggcagtcgctgggtctgccgatcgccccttacgtggcgctgcaccgcgcg
cagtttaacggcgcaggcaagcatcaggcgctggcggacatcgaagccctggggctgccg
ctgatcgtcaagccaagccgcgaaggctccagcgtcggcatgagcaaggtggaagccttc
ggcgcgctggaggcggcgctggacgaagccttccgtcacgacgacgacgtgctggtggag
aagtggctgagcggcccggagtacaccgtggcgtttatcggcgacagcgtgatgccgtcg
attcgcattcagccggccggcgtattttacgactaccaggcaaagtacattgcggacgat
acgcagtatttctgcccgagcggtttgtcggccgagcaggaggccgagctggccgcgctg
gcggtacgcgcctaccgtgcgctggactgcagcggctggggccgcgtcgatgtaatgcag
gataacgatggcagcttctatctgctcgaggtgaacacctcgccgggcatgaccagtcat
agcctggtgccgatggcagcacgtcagtatggattaagcttctcgcaactggtggcgaga
attttggaattggccgactga

DBGET integrated database retrieval system