KEGG   Streptococcus sanguinis: SSA_0222
Entry
SSA_0222          CDS       T00473                                 

Definition
(RefSeq) PTS system mannose-specific transporter subunit IID
  KO
K02771  fructose PTS system EIID component
Organism
ssa  Streptococcus sanguinis
Pathway
ssa00051  Fructose and mannose metabolism
ssa02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ssa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SSA_0222
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    SSA_0222
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssa02000]
    SSA_0222
Transporters [BR:ssa02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    SSA_0222
SSDB
Motif
Pfam: EIID-AGA DUF1304
Other DBs
NCBI-GeneID: 4806263
NCBI-ProteinID: YP_001034233
UniProt: A3CKH8
LinkDB
Position
217357..218193
AA seq 278 aa
MAERKKITKKTLAKSFHHWYYGHLTCFSQEHMQTFGYLTSMLPIVEELYKDKAEQKEAMQ
TYTAFFNTEPQLGALVVGITAGLEEARANGDAVDGETINGMRAGLMGPIAGIGDSLVVGT
LIPVLLGIALGLSKGGNPIGALFYILVWNVLIYGGMRFAYFKGYELGDKAVEFLVGPKGQ
ALRKAISVIGGMVIGAVAATWVSVTTSLELKNADGEAFLKLQEKIDGVYPGLLTAGFITL
CWWLMAKKKVSPNLVMLLLVVIALIGVALGIFDPQLKY
NT seq 837 nt   +upstreamnt  +downstreamnt
atggctgaaagaaagaaaataactaaaaagactttagcgaaatcattccaccattggtac
tatggtcatttgacttgcttctctcaagagcacatgcagactttcggctacttgacctct
atgctgccaatcgtggaagaactctacaaagacaaagctgagcagaaagaagctatgcag
acctatacagctttcttcaacacagaacctcagcttggagctttggtagtggggattaca
gctggtttggaagaagcgcgtgccaatggtgacgctgttgacggcgaaactatcaatggt
atgcgtgccggtctcatgggacctatcgcaggtatcggtgactctttggttgttggaact
ttgattccagttctgctggggattgcccttggactctctaaaggtggaaatcctatcggc
gctctcttctacatccttgtctggaatgttctcatctatggcggtatgcgctttgcctac
ttcaaaggctatgaattaggggacaaggcggtagaattccttgtaggacctaaaggacag
gcgcttcgtaaggcaatcagtgtcattggtggtatggttatcggggcagttgctgcaact
tgggtatctgtaacgacttcattagagctgaaaaatgctgatggcgaagctttcctgaag
ttgcaagaaaagattgatggtgtttatccaggtctcttaacagctggctttatcaccctt
tgttggtggctgatggccaagaaaaaagtatcaccaaacctcgttatgctcctcttggtt
gtcattgctttgattggtgtagcgcttggcatctttgaccctcaacttaaatactaa

DBGET integrated database retrieval system