KEGG   Streptococcus sanguinis: SSA_0383Help
Entry
SSA_0383          CDS       T00473                                 

Gene name
bglA
Definition
(RefSeq) Beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ssa  Streptococcus sanguinis
Pathway
ssa00010  Glycolysis / Gluconeogenesis
ssa00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ssa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSA_0383 (bglA)
   00500 Starch and sucrose metabolism
    SSA_0383 (bglA)
Enzymes [BR:ssa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SSA_0383 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 4806549
NCBI-ProteinID: YP_001034385
UniProt: A3CKY0
LinkDB All DBs
Position
374674..376113
Genome map
AA seq 479 aa AA seqDB search
MGKFPQNFLWGGATAANQYEGAYNLDGKGLSVQDVTPKGGVPAKPGDRNPLITDGPTPDN
LKLEGIDFYHRYKEDIALFAEMGFKVYRTSIAWSRIFPNGDELEPNEAGLQFYDNLFDEL
AKYGIEPLITLSHYETPLHLARQYNGWANRDLIGFYERYVRTVFTRYRDKVKYWLTFNEI
NSVLHAPFMSGGIATPAEELSKQDLYQAVHHELVASALATKIGHEINPDFKIGCMVLAMP
AYPMTPKPEDVLAAREFENQNYLFSDIHVRGKYPAYINRFFKENGIEIQFAPGDKELLAE
NTVDFISFSYYMSVVAAHDPENYSSGRGNLLGGIMNPHLASSEWGWQIDPVGLRLVLNSF
YDRYQLPLFIVENGLGAKDVLVDGPNGPTVEDDYRIDYLKQHLQQVGEALEDGVELLGYT
TWGCIDLVSASTAELSKRYGFIYVDRNDDGSGTLARYKKKSFDWYKEVIATNGDSLYQD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaatttccgcagaatttcctctggggcggtgcaactgcagccaaccagtatgaa
ggtgcctataatctggatgggaaaggcctgtctgttcaggatgtgactccaaaaggcgga
gtgccagccaagccaggtgaccgcaatcctttgattaccgatggtccgacaccagataat
ctcaagctggaagggattgatttctaccatcgctacaaggaggacattgccctctttgca
gagatgggcttcaaggtctaccgaacttccattgcctggtctcggatttttccaaatgga
gacgagctggagcccaatgaagctggtctgcaattctacgacaatctctttgacgagctg
gccaaatatggcattgagccgctgattaccctgtctcactatgaaacgcccctgcattta
gcacgtcagtacaatggctgggccaaccgtgatttgattggcttctacgagcgctatgtt
cgcacggtttttacccgctacagggacaaggtcaagtattggctgacctttaatgaaatc
aactctgttctccatgcgccctttatgagtggcggcattgccacgccagctgaagaacta
tccaagcaagacctctatcaagcagtccatcatgagctggtagcttctgctttggcaacg
aaaatcggtcatgagatcaatcctgattttaagattggctgtatggtcctggctatgcca
gcctatcctatgacacctaagccagaagatgtgctggcagcacgggaatttgaaaatcaa
aactacctcttctctgatatccatgtgcgtggaaaatatccagcctatatcaatcgtttc
ttcaaggagaatgggattgagattcagtttgcgccgggcgacaaagagcttttggctgaa
aatactgtagacttcatttccttctcttactatatgagtgttgttgcggctcatgatccg
gaaaattattcttctggccgaggcaatcttttaggtggcatcatgaatcctcatctggct
agctcagaatggggctggcagattgacccagtcggcttgcgcttggtgctaaatagcttt
tatgaccgctatcagctacctctcttcatcgtggaaaatggtctcggtgccaaggatgtc
ttggtggatggtccaaatggtccaacggttgaagatgactaccgcattgattatctcaaa
cagcatttgcagcaggtaggagaagctctggaagatggcgtagaactgctaggttacacg
acttggggctgtattgacctggtctcagccagcacggcagaactcagcaagcgttacggc
tttatctacgttgaccgcaacgatgacggtagcggaactctagcccgttataagaaaaaa
tcttttgattggtacaaagaagtcattgcgacgaatggagacagtctctatcaggattga

DBGET integrated database retrieval system