KEGG   Streptococcus sanguinis: SSA_0548Help
Entry
SSA_0548          CDS       T00473                                 

Gene name
alr
Definition
(RefSeq) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ssa  Streptococcus sanguinis
Pathway
ssa00473  D-Alanine metabolism
ssa01100  Metabolic pathways
ssa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ssa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SSA_0548 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SSA_0548 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ssa01011]
    SSA_0548 (alr)
Enzymes [BR:ssa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SSA_0548 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:ssa01011]
 Precursor biosynthesis
  Racemase
   SSA_0548 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C TIG
Motif
Other DBs
NCBI-GeneID: 4805980
NCBI-ProteinID: YP_001034542
UniProt: A3CLD7
LinkDB All DBs
Position
542480..543589
Genome map
AA seq 369 aa AA seqDB search
MMKASLHRPSKAVIDLAAIAFNIRQLSAHLPQKTEKWAVVKANAYGHGAIEVSKHIDPLV
DGFCVSNIDEALELRSAGIGKKILVLGVSDLAALPLARKGKVSLTVASLEWLDLALTAEE
DLTGLNFHIKIDSGMGRIGFRDSQEAQEAIHRLQAAGAVAEGIFTHFATADEVDHYKFEA
QLARFHQILSELDSVPPLVHASNSATSLWHSETVLNAVRLGDIIYGLNPSGTVLELPYEF
KPALSLVSELVHVKEVEAGADVGYGATYTSKSQEWIGTIPLGYADGWTRDMQGFDVLIDG
QRCPIVGRVSMDQITVRLPQAYPLGTPVVLIGNSGAETITVTDVAEKLGTINYEVVCLIS
DRVPRVYKD
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagctagtctgcatagacccagcaaggcagtgattgatttagctgccattgct
tttaatattagacaactgagtgcccatctgcctcagaagacagagaagtgggctgtcgtc
aaggccaatgcttatggtcacggagctattgaggtttctaagcatattgaccccctcgta
gatggattttgtgtgtctaatatcgatgaagccttggagctgcgctcagctggcattggc
aaaaaaattctggtgcttggagtatcagatctggctgcgcttccgctggctagaaaggga
aaggtgtctctgaccgtagccagtttagaatggttggatctagctttaactgctgaagaa
gacttgactggattgaattttcacatcaagattgactctggtatgggacggattggtttt
cgagatagtcaggaagctcaggaggcaatccatcgcttgcaggctgctggggctgtcgca
gagggaatttttacccactttgcaacggcagatgaagtggatcactataagtttgaagcc
cagctggctcgtttccatcagatcttatctgagctggacagtgttcctcctctcgttcac
gctagtaattctgccacctctctctggcacagtgagactgttctaaatgccgtccggctg
ggtgacatcatttatggcctcaaccctagcggaactgttttagaacttccttatgaattc
aagccagctctgtcgctggtctcagaattggtgcatgtcaaggaagttgaggctggagca
gatgttggctatggagccacctacaccagcaagtctcaagagtggattggcaccattcct
ttgggttatgcggatggctggacacgggatatgcagggttttgatgtcttgattgatggt
cagcgctgccctattgttggccgcgtttccatggaccaaattacagtgcgcctgcctcag
gcttatccccttggcacgccggttgtgttgattggaaatagcggagcggagaccattacg
gtgacagatgtggcagaaaagcttggcaccattaactatgaggtggtttgcttgattagc
gaccgtgtaccgagggtatataaagactaa

DBGET integrated database retrieval system