KEGG   Streptococcus sanguinis: SSA_0977Help
Entry
SSA_0977          CDS       T00473                                 

Gene name
leuB
Definition
(RefSeq) 3-isopropylmalate dehydrogenase
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
ssa  Streptococcus sanguinis
Pathway
ssa00290  Valine, leucine and isoleucine biosynthesis
ssa00660  C5-Branched dibasic acid metabolism
ssa01100  Metabolic pathways
ssa01110  Biosynthesis of secondary metabolites
ssa01210  2-Oxocarboxylic acid metabolism
ssa01230  Biosynthesis of amino acids
Module
ssa_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:ssa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    SSA_0977 (leuB)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SSA_0977 (leuB)
Enzymes [BR:ssa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     SSA_0977 (leuB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 4806851
NCBI-ProteinID: YP_001034945
UniProt: A3CMJ0
LinkDB All DBs
Position
982842..983879
Genome map
AA seq 345 aa AA seqDB search
MTKEIVALAGDGIGPEIMEAGLQVLAAVAGKFGFTYHITEKAFGGAGIDAEGHPLPQSTL
EAAKKADAILLAAIGSPQYDNAPVRPEQGLLALRKELELYANIRPVKIFDALKHLSPLKA
ERIAGVDFVVVRELTGGIYFGEHILEDKSARDINDYSYEEVERIVRKAFDIARGRRKRVT
SIDKQNVLATSKLWRRVADEVAKDYPDVTLEHQLVDSAAMLMITNPAKFDVVVTENLFGD
ILSDESSVLSGTLGVMPSASHSAAGPSLYEPIHGSAPDIAGQGIANPISMILSVAMMLRD
SFAELEAAEAIEAAVEKTLAQGILTRDLGGQAGTAQMTEAIINNL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaaattgtagctctggcgggtgatggtatcggtccagaaatcatggaggct
ggtctccaagtgctggctgctgttgcgggcaagttcggctttacttatcatatcacggag
aaggcttttgggggtgctggtattgatgcggaaggtcatcctctgcctcagtctactcta
gaagcggccaagaaggcggatgctattctcctagcagctatcggcagtccccagtatgat
aatgccccagttcgaccagagcaaggcttgctcgctctgcggaaggagcttgaactctat
gccaatatccgcccagttaagattttcgatgctcttaagcatttgtcgcctttgaaagct
gaaagaattgctggtgtggatttcgtggtcgtgcgtgagctgactggtgggatttacttt
ggtgagcatattttagaggataaatctgcgcgggatatcaacgactacagctatgaagag
gtggagcggattgtccgtaaggcctttgacattgcacgtggtcgcagaaagcgcgtgact
agtattgacaagcaaaatgtgctagcgacatccaaactctggcgtagagtagcagatgaa
gtggccaaggattatccagatgtgaccttggagcaccaactggtggacagcgctgcgatg
ctcatgattaccaatcctgctaagtttgacgttgtggtaacggaaaatctcttcggcgat
attctctcagacgagtccagcgtcttgtcaggaacgctgggagttatgccatcggccagt
cattcggctgcaggacccagtctttacgagcctatccatggttcggctccagatattgca
gggcaaggtattgccaatcctatcagcatgatactttctgtggccatgatgctgcgggat
agttttgcagagcttgaggctgcagaggcgattgaagcagcggttgagaagactttggct
cagggtattttaacccgagatcttggcggtcaggcagggacagctcaaatgacggaggca
attattaataacttatga

DBGET integrated database retrieval system