KEGG   Streptococcus sanguinis: SSA_1151Help
Entry
SSA_1151          CDS       T00473                                 

Gene name
tdk
Definition
(RefSeq) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ssa  Streptococcus sanguinis
Pathway
ssa00240  Pyrimidine metabolism
ssa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SSA_1151 (tdk)
Enzymes [BR:ssa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SSA_1151 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 KdpD AAA_14 AAA_30 ATPase_2 AAA SRP54
Motif
Other DBs
NCBI-GeneID: 4806402
NCBI-ProteinID: YP_001035109
UniProt: A3CN04
LinkDB All DBs
Position
1180290..1180862
Genome map
AA seq 190 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKSVVIMTSAVDTRDGFGVVSSRIGMKRNAI
AIEDQTDIFGYIQQLPEKPYCVLIDEAQFLKRHHVYDLARVVDELDVPVMAFGLKNDFRN
ELFEGSKHLLLLADKIEEIKTICQYCSRKATMVLRTDNGKPVYDGEQIKIGGHETYISVC
RKHYFNPDIK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggctcagttatactacaaatatggtacgatgaattcgggtaagactattgaaattttg
aaagtggcccacaattatgaagaacaaggcaagagcgtggttatcatgacctcggctgtt
gacacccgcgacggctttggtgttgtttctagtcgcatcggcatgaagcggaatgctata
gctattgaagaccagacggatatttttggctatatccagcagttgcctgaaaaaccttat
tgcgttttgatcgatgaggctcagttcttgaaacgccatcatgtctatgatttggctaga
gtggtggatgagctggatgttcctgttatggcttttggtctgaaaaatgactttcgcaat
gaactttttgagggttccaagcacctcttgctcttggctgacaagattgaggagattaaa
accatttgccaatattgctctcgtaaggccaccatggttttacggactgataacggaaag
ccggtttatgacggagagcagattaaaattggcggccacgagacctatatctcagtctgc
cgcaagcactattttaaccccgatattaagtaa

DBGET integrated database retrieval system