KEGG   Streptococcus sanguinis: SSA_1175Help
Entry
SSA_1175          CDS       T00473                                 

Gene name
acoC
Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ssa  Streptococcus sanguinis
Pathway
ssa00010  Glycolysis / Gluconeogenesis
ssa00020  Citrate cycle (TCA cycle)
ssa00620  Pyruvate metabolism
ssa01100  Metabolic pathways
ssa01110  Biosynthesis of secondary metabolites
ssa01120  Microbial metabolism in diverse environments
ssa01130  Biosynthesis of antibiotics
ssa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ssa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSA_1175 (acoC)
   00020 Citrate cycle (TCA cycle)
    SSA_1175 (acoC)
   00620 Pyruvate metabolism
    SSA_1175 (acoC)
Enzymes [BR:ssa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SSA_1175 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding
Motif
Other DBs
NCBI-GeneID: 4806480
NCBI-ProteinID: YP_001035131
UniProt: A3CN26
LinkDB All DBs
Position
complement(1203023..1204066)
Genome map
AA seq 347 aa AA seqDB search
MADDKLRATPAARKLADDLGINLYDVSGSGANGRVHKEDVETYKDTNVVRISPLAKRIAQ
EHNIAWQEIQGTGHRGKIMKKDVLVFLPENVESDTIKSPAQIEKAEEVPDNVTPYGEIER
IPMTPMRKVISQRMVESYLTAPTFTLNYDVDMTEMLALRKKVLDPIMEATGKKVTVTDLL
SLAVVKTLMKHPYLNSTLTENGKTIITHNYVNLSMAVGMDNGLMTPVVYNAEKMSLSELV
VAFKDVIGRTLEGKLAPSELQNSTFTISNLGMFGVQSFGPIINQPNSAILGVSSTVEKPV
VVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKALIEDPISMLV
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgataagctaagagcgactcctgcagctagaaagttagcggatgatttggga
atcaacctctatgatgtttctggctcaggcgcaaacggtcgtgtccacaaagaagacgtg
gaaacttataaagatacaaatgtggtgcgcatttcaccactggcaaaacgaattgcccaa
gaacacaatattgcttggcaagagattcaaggaactggccatcgtggcaagattatgaag
aaagatgttcttgttttcttgcctgagaatgttgagagcgatacaatcaaatctcctgct
caaattgaaaaagcggaagaagtgcctgataatgtcactccttatggtgagattgagcgt
atcccaatgacgccgatgcggaaggtcatttctcagcggatggtagaatcttacctaact
gcgccaaccttcaccctcaactatgatgttgatatgacagaaatgctggccttgcgtaaa
aaagtgctggatccaatcatggaagcaactggcaagaaagtaactgtcacagacctgctt
tcgctggctgttgtgaagacgttgatgaaacatccttatctcaattcgaccttgacagag
aacggcaagaccattatcacacacaactatgtcaacctttcaatggcagtcggtatggat
aatggcctgatgacaccagttgtctacaatgcagaaaaaatgagcctatcagagcttgtg
gtagcctttaaagatgtaatcggacgtaccttggaaggcaaattagctccaagcgagctg
caaaattcaaccttcacaatcagtaacttaggtatgtttggcgttcagtcttttgggcca
atcatcaaccagccaaactctgctatcttgggtgtgagctcaacggtagagaaacctgtc
gttgttaatggcgaaattgttatccgtccaattatgagtctgggcttgacgattgaccac
cgtgtagttgacggaatggctggagctaagtttatgaaggacttgaaggctttgattgaa
gacccaatttcaatgttggtataa

DBGET integrated database retrieval system