KEGG   Streptococcus sanguinis: SSA_1237Help
Entry
SSA_1237          CDS       T00473                                 

Gene name
ung
Definition
(RefSeq) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
ssa  Streptococcus sanguinis
Pathway
ssa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ssa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SSA_1237 (ung)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ssa03400]
    SSA_1237 (ung)
Enzymes [BR:ssa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     SSA_1237 (ung)
DNA repair and recombination proteins [BR:ssa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SSA_1237 (ung)
 Prokaryotic type
     SSA_1237 (ung)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-GeneID: 4806385
NCBI-ProteinID: YP_001035190
UniProt: A3CN85
LinkDB All DBs
Position
complement(1261803..1262456)
Genome map
AA seq 217 aa AA seqDB search
MQHSAWHALIKEQLPEGYFAKINHFLDEVYASGTIYPPREKVFNAIQTTDLADVKVVILG
QDPYHGPRQAQGLSFSVPDDIPAPPSLQNILKELADDIGVKESHDLTSWAQQGVLLLNAG
LTVPAGQANAHAGLIWESFTDAIIKVVNEKSDPVVFILWGSYARKKKALISNPQHLIIES
AHPSPLSAYRGFFGSKPFSRTNDFLVAKGLEPINWLA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgcagcattcagcttggcacgctttgattaaggaacagctgccggaaggttattttgca
aaaatcaatcattttttagatgaagtgtatgcttcggggaccatttacccacctcgggaa
aaggtgtttaatgcgattcagacgacagatttagcagatgttaaggtggttattttaggg
caggacccctaccacggaccgagacaggcacagggcttgagtttttcggtacctgatgat
attccagctccgccttctttgcagaatattctcaaagaactggctgatgatatcggagtg
aaagagtcgcatgatttgacttcctgggctcagcaaggtgttctcttgctcaatgctggg
ctgactgtgcctgctggtcaggccaatgcgcatgcaggtttaatctgggagtcatttaca
gatgctattatcaaggtagtcaatgaaaagtctgatccagtcgtctttatcctatggggt
tcatacgcccgcaagaaaaaagccttgataagcaatcctcaacatttgataatcgagtcg
gctcacccaagcccgctgtctgcttaccgtggtttctttggtagtaaacctttttctcgt
accaatgatttcttagtggctaagggcttggaacctatcaattggttagcatag

DBGET integrated database retrieval system