KEGG   Spiroplasma sabaudiense: SSABA_v1c06600Help
Entry
SSABA_v1c06600    CDS       T03048                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ssab  Spiroplasma sabaudiense
Brite
KEGG Orthology (KO) [BR:ssab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssab01001]
    SSABA_v1c06600
Enzymes [BR:ssab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SSABA_v1c06600
Protein kinases [BR:ssab01001]
 Serine/threonine kinases: Other
  Bacterial family
   SSABA_v1c06600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Haspin_kinase APH RIO1
Motif
Other DBs
NCBI-ProteinID: AHI54062
UniProt: W6AAH8
LinkDB All DBs
Position
complement(758540..759565)
Genome map
AA seq 341 aa AA seqDB search
MKEYKKGDLIAGRYNVVKPIGKGGMASVFEAEDVWTHERVAVKAIAEAMVVKDTAQMRFD
IEKEAFAKLGQNPYVVKLYDVIQNGTDWFIVLELVNGGTLKDRLLDFGPMTLPELKHYFG
QISNALIEAHEIGIVHRDIKPDNVLLTKSGQVKLGDFGISIMMEQENQESSKAIGTPKYM
PPEIIAHQKPTPLSDMYSLGIMLYELTVGQAPFIGKTPEIIAAKHVKEIPTPPIMVDKNI
PMALNNLILRSIEKNPVDRYKNMQAFRDELLKISNDSTEKTKPWNSKRVVNLKNSKSAKK
SIKIGNNYDRMPRFLKPHFIAIYCVVMLMLILGLVLIILFV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaatataaaaaaggtgacctaattgcaggaagatacaatgtagtaaaaccgatt
ggtaaaggcggaatggcttcggtttttgaagcagaggatgtctgaacacatgagcgagtt
gctgttaaagcaattgctgaagcaatggtagttaaagatactgcccaaatgcgttttgat
attgaaaaggaagcctttgctaaattaggtcaaaacccttatgttgttaaactgtacgat
gttattcaaaatggaactgattgatttattgtcttagaattggtaaatggtggaacacta
aaagatagacttttggattttggaccaatgacattacctgaactaaaacattactttggg
caaataagtaatgctttaattgaagctcacgaaattggaattgttcatagagatattaaa
cccgataatgttcttttaaccaagtcaggccaagtaaaactgggtgactttggaatttca
ataatgatggaacaagaaaatcaagaatcttcaaaagcaattgggactcccaaatatatg
cccccagaaattattgctcaccaaaaaccaactcctttgagcgatatgtattctttggga
ataatgctttatgaattgacggttggacaagctccttttataggaaaaactccagaaatt
attgcagcaaaacacgtcaaggaaatcccaaccccgccaataatggtagacaagaatatt
ccgatggctctaaataatttaattttaagatcaattgagaaaaatcctgttgataggtac
aaaaatatgcaagcctttagagatgaattattaaaaatctcaaatgattcaacagaaaaa
acaaagccatgaaactcaaaaagagtggtaaatctaaaaaattcaaaatctgctaaaaaa
tctataaaaatagggaataactatgacagaatgccaaggtttttaaaacctcattttatt
gcaatatactgcgttgtaatgttaatgttgattttaggtttggttttaattattttattt
gtttaa

DBGET integrated database retrieval system