KEGG   Streptococcus salivarius HSISS4: HSISS4_00055Help
Entry
HSISS4_00055      CDS       T04634                                 

Gene name
trxB1B
Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ssah  Streptococcus salivarius HSISS4
Brite
KEGG Orthology (KO) [BR:ssah00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HSISS4_00055 (trxB1B)
Enzymes [BR:ssah01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HSISS4_00055 (trxB1B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA FAD_oxidored Thioredoxin_3 HI0933_like Thi4 DAO AlaDh_PNT_C FAD_binding_3 NAD_binding_7 NAD_binding_8 Lycopene_cycl Thioredoxin_9 Glutaredoxin K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ALR79067
LinkDB All DBs
Position
complement(77538..79070)
Genome map
AA seq 510 aa AA seqDB search
MVLDKEIKTQLAQYLNLLESDIVLQTDLGDDDNSRKVKEFLDEIAAMSDRISLESTHLKR
QPSFGIAQKGQKSRVIFSGLPMGHEFTSFILALLQVSGRPPKVDEDTIERIKKIDKPIDL
ETYVSLTCHNCPDVVQAFNIMAVLNPNITHTMIEGGMYQDEVKAKGIMSVPTVYKDQEEF
TSGRATIEQLVEKLDGPLDADAFADKGVYDVLVIGGGPAGNSAAIYAARKGLKTGLLAET
FGGQVIETVGIENMIGTLYTEGPKLMAQVEEHTKSYDVDIIKSQLATGIEKKELIEVTLA
NGAVLKSKTAILALGAKWRNINVLGEEEFRNKGVTYCPHCDGPLFEGKNVAVIGGGNSGL
EAALDLAGITKHVTVLEFLPELKADQVLQERAAKTDNLTILKNVATKEIVGQDHVTGLNY
VERDTNEEKHLDLEGVFVQIGLVPSTAWLKDSGIELNERQEIIVDKFGSTNIPGIFAAGD
CTDSAYKQIIISMGSGATAAIGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggtcttagataaagaaatcaagacgcaattagcacaatatttaaatttactagaatct
gatattgtattacaaacagatttaggggatgacgataattctcgaaaagtaaaagaattt
cttgacgagattgccgctatgtctgaccgcattagtcttgaatcaacacatttaaaacgt
caacctagttttggtattgcacaaaaagggcaaaaaagtcgcgttattttctcaggctta
ccaatgggccacgaattcacgtctttcattttagctctcttgcaagtttctggtcgtcca
cctaaagttgatgaggatactatcgaacgtatcaagaagattgataaacccatcgactta
gagacttatgtttcattaacttgtcacaattgtccagacgttgtgcaagcctttaatata
atggctgttttgaacccaaatatcactcacaccatgattgaaggtggtatgtatcaggat
gaggtcaaagccaaaggtatcatgtctgttcctacggtttacaaagaccaagaagaattt
acatctggtcgtgcaaccattgaacagcttgttgaaaaattggacggaccacttgatgct
gatgctttcgctgataaaggtgtctatgatgttttggttattggtggtggtcctgctgga
aacagtgcggccatctatgctgcccgtaaaggtttaaaaactggtcttttagcagaaacc
tttggtggacaagttatcgagacagtcggcattgagaacatgattggtacgctatataca
gaaggtcctaagttaatggcccaagttgaagagcatacgaaatcttatgatgttgatatc
atcaaaagtcaattagctactggcattgagaagaaagaacttattgaagtgacactggct
aacggtgccgttttaaaatccaaaactgctatcctagctctcggagctaaatggcgtaat
atcaacgttcttggcgaggaagaattccgcaataaaggggttacttactgcccacactgt
gatggtccactatttgaagggaagaatgttgcagttatcggtggtggtaactcaggtttg
gaagcggctttagatttagcaggcattactaaacatgttacagtcttagagttcttacct
gaattaaaggcagatcaagtcttacaagaacgagctgctaaaactgataatctaaccatt
cttaagaacgttgcaaccaaagaaattgttggtcaagatcatgtaactggtttgaattac
gttgagcgtgatacaaacgaagaaaaacatcttgatcttgaaggtgtctttgttcaaatt
ggtcttgtaccaagtactgcttggctcaaagatagtggtattgaactcaatgagcgccaa
gaaattatcgttgataaatttggttcaacaaatatccctggtatttttgctgcaggtgac
tgtacagatagtgcctacaagcaaatcattatctccatggggtctggtgctacggctgct
attggagcctttgattacttgattagacaataa

DBGET integrated database retrieval system