KEGG   Streptococcus salivarius HSISS4: HSISS4_00674Help
Entry
HSISS4_00674      CDS       T04634                                 

Gene name
sodA
Definition
(GenBank) Manganese superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ssah  Streptococcus salivarius HSISS4
Brite
Enzymes [BR:ssah01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HSISS4_00674 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ALR79686
UniProt: A0A0A1DUC0
LinkDB All DBs
Position
724432..725037
Genome map
AA seq 201 aa AA seqDB search
MAIILPDLPYAYDALEPYIDAETMTLHHDKHHATYVANANAALEKHPEIGEDLEALLADV
EQIPADIRQALINNGGGHLNHALFWELLSPEKQEPTAEVAAAINEAFGSFEAFQEAFTAA
ATTRFGSGWAWLVVNAEGKLEVVSTANQDTPISDGKKPILALDVWEHAYYLNYRNVRPNY
IKAFFEIINWNKVAELYAAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaattatccttccagaccttccttacgcttacgacgctttggaaccatacattgat
gctgaaacaatgactcttcaccacgataaacaccacgcaacttatgtagcaaatgctaat
gctgctcttgaaaaacacccagaaattggtgaagatctcgaagcacttttggctgacgtg
gaacaaattccagcagatattcgtcaagcacttattaacaatggtggtggacaccttaat
cacgcacttttctgggaactcttgtctcctgaaaaacaagaaccaactgcagaagtagca
gctgctattaacgaagctttcggctcatttgaagctttccaagaagctttcacagcagca
gcaacaactcgttttggttcaggttgggcatggcttgttgttaacgctgaaggtaagctt
gaagtcgtttcaactgctaaccaagatactcctatctcagacggtaagaaaccaatcttg
gcacttgatgtttgggaacatgcatactacctaaactaccgtaacgtacgtccaaactac
atcaaagctttctttgaaatcattaactggaataaagttgctgagctttatgcagcagct
aaataa

DBGET integrated database retrieval system