KEGG   Streptococcus salivarius HSISS4: HSISS4_00913Help
Entry
HSISS4_00913      CDS       T04634                                 

Gene name
acoC2
Definition
(GenBank) Dihydrolipoamide acetyltransferase component (E2) of acetoin dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ssah  Streptococcus salivarius HSISS4
Pathway
ssah00010  Glycolysis / Gluconeogenesis
ssah00020  Citrate cycle (TCA cycle)
ssah00620  Pyruvate metabolism
ssah01100  Metabolic pathways
ssah01110  Biosynthesis of secondary metabolites
ssah01120  Microbial metabolism in diverse environments
ssah01130  Biosynthesis of antibiotics
ssah01200  Carbon metabolism
Module
ssah_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ssah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HSISS4_00913 (acoC2)
   00020 Citrate cycle (TCA cycle)
    HSISS4_00913 (acoC2)
   00620 Pyruvate metabolism
    HSISS4_00913 (acoC2)
Enzymes [BR:ssah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HSISS4_00913 (acoC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ALR79925
LinkDB All DBs
Position
989827..991197
Genome map
AA seq 456 aa AA seqDB search
MPKLGVDMQEGEIIEWKKQEGDVVNEGDILLEIMSDKTNMELEAEDSGVLLKITRQAGET
VPVTEVIGYIGAEGEVVADNAASAPAVEAAPKVEEVAAVETPVVAAQTQAPVVHEGGKVR
ATPKARKVARELGIDLTQVPGTGAKGRVHADDVENFKGAQPKATPLARKIAADLGIDLAS
VSGTGFGGKITKEDILAISAPAQVKEAAAAPVVEAKPEKVLPEGVEVIPMSAMRKAISKG
MTHSYLTAPTFTLNYDVDMTNLMALRKQVLDPIMNKTGMKVTFTDLIGLAVVRTLMKEEH
RYLNASLIDDAQNIELHKFVNLGIAVGLDDGLIVPVVHGADKMSLSEFVVASKDVIKKAQ
AGKLKAAEMSGSTFSITNLGMFGTKSFNPIINQPNSAILGVSATIQTPVVVDGEVVVRPI
MGLCLTIDHRIVDGMNGAKFMVDLKHLIENPMELLI
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagcttggtgttgatatgcaggaaggcgaaatcatcgagtggaaaaaacaagag
ggtgatgtggttaatgagggagatatccttcttgaaatcatgtctgataaaacaaacatg
gaacttgaagcagaggattcaggtgtccttttgaagattacacgtcaggctggtgaaaca
gttccagttactgaggttatcggttatattggagcagaaggtgaagttgtggctgataat
gctgcgagtgcacctgcagttgaagctgctccaaaagttgaagaagttgccgctgtagaa
acacctgtagtagcagcgcaaacacaagcccctgtcgttcatgaaggtgggaaggtacgt
gcaacgcctaaggcgcgtaaggtggcgcgtgagttgggaattgaccttactcaagttcca
ggaactggagcaaaaggtcgtgttcacgcggatgacgttgagaactttaagggtgctcaa
cctaaggcaacaccattggcacgtaagattgctgcggaccttggtattgatttagctagc
gtgtctggaacaggctttggtggtaagattactaaggaagatatccttgcaatcagtgct
ccagcgcaagttaaggaagctgcagctgcacctgtggttgaagctaaacctgaaaaagtc
ttgccagaaggtgtggaagttattccaatgtctgctatgcgtaaggctatttctaaggga
atgacgcactcatacttgactgcaccaaccttcacccttaactatgacgtggacatgact
aaccttatggccctacgtaagcaagtccttgacccaatcatgaacaagactggcatgaag
gtaaccttcactgatttgattggtttagcagttgtgcgtacccttatgaaagaggaacac
cgttacctcaatgcatccttgattgatgatgcacaaaatatcgaattacacaaatttgtt
aatctcggtattgccgttggtctcgatgatggcttgattgtaccagttgtacatggtgca
gataagatgagtttgtctgagtttgttgtggcatctaaagatgtcatcaagaaagctcaa
gctggtaagttgaaggctgctgaaatgtcaggttcaaccttctctattactaacttggga
atgtttggaaccaagtcattcaatccaatcattaaccaaccaaactcagctatccttggt
gtttcagcaactattcagacaccggttgtcgttgatggtgaagttgttgtgcgtccaatc
atgggtctctgcttgacaattgaccaccgtattgtagatggtatgaatggtgccaaattc
atggttgatttgaagcatttgattgaaaatccaatggaattgttgatttga

DBGET integrated database retrieval system