KEGG   Streptococcus salivarius HSISS4: HSISS4_01488Help
Entry
HSISS4_01488      CDS       T04634                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ssah  Streptococcus salivarius HSISS4
Pathway
ssah00473  D-Alanine metabolism
ssah00550  Peptidoglycan biosynthesis
ssah01100  Metabolic pathways
ssah01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ssah00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    HSISS4_01488 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HSISS4_01488 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    HSISS4_01488 (ddl)
Enzymes [BR:ssah01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HSISS4_01488 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:ssah01011]
 Precursor biosynthesis
  Amino acid ligase
   HSISS4_01488 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST GARS_A MsyB
Motif
Other DBs
NCBI-ProteinID: ALR80500
LinkDB All DBs
Position
complement(1684520..1685566)
Genome map
AA seq 348 aa AA seqDB search
MSKQTLILLYGGRSAEREVSVLSAESVMRAVDYSAFEVKTYFITQSGDFIKTQEFTETPG
DDEKLMTNDTVVASQAIKPSDIYEEGAVVFPVLHGPMGEDGSIQGFLETLKLPYVGTNVL
SSSVAMDKIMTKHILEVAGVPQVAYTVFIEGEDLEVAVAETLEKLTFPVFVKPANMGSSV
GISKAENEAELRAAIDLALKYDSRILIEQGVVAREIEVGILGNTNVKTTDPGEVVKDVAF
YDYQAKYIDNKITMDIPAHVPAEVMTQMRAYAAKAFRALGGCGLARCDFFLTEDGAIYLN
ELNTMPGFTQWSMYPLLWENMGLSYSDLIKELVALGQEMFEKRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacaaacccttatccttctctacggtggacgttcagcagaacgtgaagtgtct
gtgctctcagctgagagtgttatgcgtgcggtggattacagcgcatttgaggttaaaacc
tactttatcactcagtctggtgattttatcaaaacacaagaatttacagaaacaccaggt
gatgacgagaagcttatgactaatgacacagttgtggctagtcaggctatcaaaccaagc
gatatttatgaagaaggcgctgtggtattccctgtgctccatggacctatgggtgaggat
ggttctatccaaggtttcctcgaaaccctcaaattgccatatgtgggtactaatgttctt
tcttcaagtgtggctatggacaagattatgaccaagcatattcttgaagttgctggtgtg
cctcaggttgcctacacagtcttcatcgagggtgaagatttggaagtagcagtagctgaa
acgcttgaaaaattgaccttcccagtgtttgtcaaacctgctaacatggggtcatctgtt
gggatttctaaagctgaaaatgaagcagagcttcgtgcagcgattgatttggctctcaaa
tatgatagtcgtatcttgattgagcaaggtgtggttgcccgagaaatcgaggttggtatc
cttggcaatacaaatgtcaaaacgactgatccaggtgaagtagtcaaagatgtggctttc
tatgactatcaagccaagtacattgacaataagattaccatggacatcccagctcacgtg
cctgcagaagtcatgacgcaaatgcgtgcctatgcggccaaggccttccgtgccctcggt
ggttgtggtcttgcccgctgtgatttcttcctgacagaggatggagccatctaccttaac
gagctcaacactatgccaggtttcactcaatggtctatgtacccacttctttgggaaaat
atgggactttcttactcagaccttatcaaggaattggtagccttgggacaagaaatgttc
gagaaacgtgaaagccatttgatttaa

DBGET integrated database retrieval system