KEGG   Streptococcus salivarius HSISS4: HSISS4_01535Help
Entry
HSISS4_01535      CDS       T04634                                 

Gene name
adhB2
Definition
(GenBank) 2,3-butanediol dehydrogenase, R-alcohol forming, (R)- and (S)-acetoin-specific
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ssah  Streptococcus salivarius HSISS4
Pathway
ssah00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ssah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    HSISS4_01535 (adhB2)
Enzymes [BR:ssah01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     HSISS4_01535 (adhB2)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     HSISS4_01535 (adhB2)
    1.1.1.-  
     HSISS4_01535 (adhB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: ALR80547
LinkDB All DBs
Position
complement(1730066..1731109)
Genome map
AA seq 347 aa AA seqDB search
MATMKAARWHAAKDVRIEEVEVPEVQPHQVKVAVKFTGICGTDLHEYLDGPIFIPTEEHV
YSGQKAPVTLGHEFSGEIVEVGSDVTRVKVGDRVTIEPILAEHNLIGDYNLDPNLNFVGL
AADGGFAKYCVLDGDLVHVIPDSLSYEQAALTEPAAVAVYAVRQSALKAGDTAVIFGLGP
IGLLIVEALRAAGASKIFAVELSPERQAKAEELGAIVVRPEEGETVVEAIHRLTGGGADV
SYEVTGVPVVLGQALAAVHKAGECMVVSIWEREANINPNEFAIQEKSLKGIIAYRHIFPK
VLELMEQGYFPADKLVTKKIKLENIVEEGFVELTQDKSQIKILVEPE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctacaatgaaagcagctcgctggcatgcagcgaaagacgttcgtatcgaagaagtg
gaagtacctgaagtacaacctcatcaagtaaaagtagcggtcaagttcacgggaatctgt
ggtacggacttgcatgaatatttggatggaccaatcttcattccaacagaagaacatgtt
tattctggtcaaaaagcaccggttactttgggacatgaattctctggtgaaattgtggaa
gtcggaagtgatgtgactcgtgttaaagttggtgatcgtgtaaccatcgaaccaattctt
gcagagcacaacttgattggtgattataaccttgatccaaacttgaacttcgtcggtctc
gctgcagatggtggttttgcaaaatattgtgtccttgatggtgatcttgtccatgtaatt
ccagatagcttgagttatgaacaagccgctcttacagaacctgcagctgtagctgtttat
gctgttcgtcaatctgctttgaaagctggtgacacagcagtcatctttggcttgggacca
attggtctcttgattgttgaggcccttcgtgcagcaggcgcatcaaaaatctttgcggtt
gaattgtctcctgaacgtcaagccaaggcagaagaattgggagcaatcgttgttcgtcca
gaagaaggagaaacagtcgtagaagctatccatcgtttgacaggtggtggagcagatgtt
tcttacgaagttactggggttccagttgttttaggccaagcccttgcagctgttcataaa
gctggggaatgtatggtcgtatctatctgggaacgtgaagccaacatcaatccaaatgaa
ttcgccatccaagaaaaatctctcaaaggaattattgcctaccgtcacatcttccctaaa
gttttggaattgatggaacaaggctacttccctgctgataaattggttactaagaaaatt
aaattggaaaatatcgttgaagaaggatttgttgaattaacacaagataaatctcaaatt
aagatcttagttgaaccagaataa

DBGET integrated database retrieval system