KEGG   Streptococcus salivarius HSISS4: HSISS4_01549Help
Entry
HSISS4_01549      CDS       T04634                                 

Gene name
aspC2B
Definition
(GenBank) Alanine transaminase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ssah  Streptococcus salivarius HSISS4
Pathway
ssah00220  Arginine biosynthesis
ssah00250  Alanine, aspartate and glutamate metabolism
ssah00290  Valine, leucine and isoleucine biosynthesis
ssah01100  Metabolic pathways
ssah01110  Biosynthesis of secondary metabolites
ssah01130  Biosynthesis of antibiotics
ssah01210  2-Oxocarboxylic acid metabolism
ssah01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssah00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HSISS4_01549 (aspC2B)
   00290 Valine, leucine and isoleucine biosynthesis
    HSISS4_01549 (aspC2B)
   00220 Arginine biosynthesis
    HSISS4_01549 (aspC2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssah01007]
    HSISS4_01549 (aspC2B)
Enzymes [BR:ssah01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     HSISS4_01549 (aspC2B)
    2.6.1.66  valine---pyruvate transaminase
     HSISS4_01549 (aspC2B)
Amino acid related enzymes [BR:ssah01007]
 Aminotransferase (transaminase)
  Class I
   HSISS4_01549 (aspC2B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ALR80561
UniProt: A0A074J1Y6
LinkDB All DBs
Position
complement(1744841..1746055)
Genome map
AA seq 404 aa AA seqDB search
MKTFDKSSKLDHVAYDIRGPVLDEANRMIANGEKILRLNTGNPAEFGFTAPDEVIRDLIM
NVRNSEGYSDSKGIFSARKAIMQYCQLKGFPNVDIDDIYIGNGVSEMISMSMQALLDDGD
EVLVPMPDYPLWTACVSLAGGNAVHYVCDEKSNWYPDIDDIKSKITSNTKAIVVINPNNP
TGSLYPKDVLEQIVDIARQNDLIIFADEIYDRLVMDGKKHTAIASLAPDVFCVSMNGLSK
SHRICGFRVGWMVLSGPKKNVKGYIEGLNMLANMRLCANVLSQHVIQTSLGGYQSVDELL
IPGGRIYEQREFITNTVNAIPGLSAVKPDAGLYIFPKIDRNMYDIEDDEEFCLRLLKKEK
VLLVPGKGFNWNEPDHFRIVYLPRVEELADLGNKIERVLSYYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatttgataaatcatcaaagttggatcacgttgcttatgatattcgtggacca
gttttggatgaagccaaccgtatgattgccaatggtgaaaagattcttcgtcttaataca
ggaaatcctgcggaatttggctttacagcaccggatgaagtcattcgtgatttaattatg
aatgttcgtaacagtgaagggtattcggatagtaaggggattttctcagctcgtaaggcg
attatgcagtattgccagctaaagggattcccaaatgtagatattgatgatatttatatt
ggtaatggtgtttcagagatgatttccatgtctatgcaggccttgcttgatgatggagat
gaggttttggtcccaatgcctgactatcctctttggactgcctgtgtcagtctagcaggc
ggtaatgccgtacactatgtctgtgatgaaaaatctaactggtatccagatattgatgat
atcaaatcaaagattacgtcaaatactaaggcaattgtagtcatcaatcccaataatcct
acaggttcactctatcctaaggatgttcttgaacagattgtggatattgctcgacaaaat
gatttgattatctttgcggatgagatttatgaccgcttggttatggatggtaaaaagcat
actgcgattgctagtcttgcaccagatgttttctgtgtgtctatgaatggtctttctaag
tctcaccgtatctgtggtttccgtgtaggttggatggttctctctggacctaaaaagaat
gtcaaaggctatattgaagggcttaatatgttggccaacatgcgtctttgtgccaatgtg
ctctctcagcacgttattcagacttcacttggtggctaccaatctgtggatgagctcttg
attcctggtggacgtatctatgaacaacgtgagtttattacgaataccgtaaacgctatt
ccagggctttcagctgttaagccagatgcagggctttacatcttccctaagattgaccgt
aacatgtatgatattgaagatgatgaagaattctgtcttcgtctcttgaagaaggagaag
gttctcctagttccaggtaaaggctttaactggaatgaaccagatcacttccgtattgtc
taccttcctcgtgtggaagagttggctgatctcggtaacaaaatcgaacgagtcttgtca
tattacaagcgttaa

DBGET integrated database retrieval system