KEGG   Spiribacter salinus: SPISAL_05535Help
Entry
SPISAL_05535      CDS       T02685                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ssal  Spiribacter salinus
Pathway
ssal00020  Citrate cycle (TCA cycle)
ssal00190  Oxidative phosphorylation
ssal00650  Butanoate metabolism
ssal01100  Metabolic pathways
ssal01110  Biosynthesis of secondary metabolites
ssal01120  Microbial metabolism in diverse environments
ssal01130  Biosynthesis of antibiotics
ssal01200  Carbon metabolism
Module
ssal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ssal_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ssal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPISAL_05535 (sdhB)
   00650 Butanoate metabolism
    SPISAL_05535 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SPISAL_05535 (sdhB)
Enzymes [BR:ssal01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SPISAL_05535 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     SPISAL_05535 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-ProteinID: AGM41201
UniProt: R4VG64
LinkDB All DBs
Position
complement(1126882..1127661)
Genome map
AA seq 259 aa AA seqDB search
MAQFILPPNSRIKQGEHHAAPEGVANTRIFKVYRWEPDSGENPRLDTYEVDLDTCGPMVL
DALVKIKNEIDPTLTFRRSCREGICGSCAMNIDGRNTLACTKAIDEIDNEVRIYPLPSMR
VVKDLVPDMTHFYAQYASIRPWIRTQTPPPPDRERLQSPEDREELDGLYECIMCACCQTS
CPSYWWNPDRYLGPAILLQAYRWVADSRDEDTGARLDDLDDAFKLYRCHTIMNCASACPK
GLNPAKAIAELKRLMVARQ
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcccagttcatcctgcccccgaattcccgcatcaagcagggcgagcaccatgccgcg
cctgagggcgtagcgaatacgcggatcttcaaggtctatcgatgggagcctgacagtggt
gaaaacccccggctcgatacctacgaggttgacctcgacacctgtggcccaatggtgctc
gacgcccttgtgaagattaaaaacgagattgacccgacgttaaccttccggcgctcctgc
cgtgaggggatctgcgggtcgtgcgcgatgaacattgacgggcgcaatacgctggcctgc
accaaggcaatcgatgaaatcgataacgaggtacgcatctacccgttgccgtccatgcgg
gttgtaaaagacctcgtgcccgacatgacgcacttctatgcacagtatgcctcgatccgt
ccctggatcaggacgcaaacgccgccgccaccggatcgcgagcgcttgcagagccccgag
gaccgcgaagagctcgacggcctctacgagtgcattatgtgtgcgtgttgccagacctcc
tgcccaagttactggtggaacccggatcgctacctcggcccggctattctgctgcaggcg
taccgctgggtagcggatagtcgtgatgaggacaccggtgcgcggttggatgatctggac
gatgcattcaagctttaccggtgtcatacgatcatgaactgtgcctcggcgtgtccgaag
ggattgaacccggccaaggcgattgctgagctgaaacgcttgatggtggctcggcagtag

DBGET integrated database retrieval system