KEGG   Spiribacter salinus: SPISAL_07110Help
Entry
SPISAL_07110      CDS       T02685                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit B; Glutamyl-tRNA(Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ssal  Spiribacter salinus
Pathway
ssal00970  Aminoacyl-tRNA biosynthesis
ssal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssal00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPISAL_07110
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ssal03029]
    SPISAL_07110
Enzymes [BR:ssal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SPISAL_07110
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SPISAL_07110
Mitochondrial biogenesis [BR:ssal03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SPISAL_07110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: AGM41516
UniProt: R4VH40
LinkDB All DBs
Position
complement(1455088..1456521)
Genome map
AA seq 477 aa AA seqDB search
MQWEAVIGLELHAQLATNTKIFSGASTAYGAQANTQACAIDLGMPGVLPVLNERAVRFAI
RLGLALDATVAGRSVFARKNYFYPDLPKGYQISQYEIPVVGTGHLDIDLDDGERKRIGVT
RAHLEEDAGKSLHEGFGAMSGIDLNRAGTPLLEIVSEPDLRTAKEAVAYMKKMHSLVRYL
GICDGNMQEGSFRCDANVSVRPVGQLAFGTRAEIKNLNSFRFVERAINYEIERQIEVLED
GGTITQETRLFDSDRGETRAMRGKEEANDYRYFPDPDLLPLEITPALIDEVRDELPELPD
AKRNRFVADYGLSDYDAANLTASRDLADYFEAVAGRCSDAKLAANWVMGELSGALNREGL
EIGETPVDAEALANLLRRILDDTISGKIAKEVFEAMWQGEGDADAVIADRGLEQVTDSSA
IEALVDEAIAANPEQLEQYRAGKTKLMGFFVGQVMKACGGKANPQQVNEILKQRLDG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgggaagcggttatcggcctcgagctgcacgcgcagcttgccacgaacacgaag
attttctcgggtgcctcgacggcgtacggggcgcaggccaatacccaggcctgcgcgatc
gacctgggcatgccaggcgttctgcccgtgctcaacgaacgggcggtgcgtttcgcaatt
cgccttgggctggcgctggatgccacggtggccggacgctcggtctttgcccgaaaaaat
tacttttacccggatctgcccaagggctatcagatctcccaatatgagatccccgtggtg
ggcacgggccatctggacattgatctcgacgacggcgagcgcaagcgcatcggcgtcact
cgggcccatctggaggaggacgcgggcaagagcctgcatgaaggcttcggcgcgatgagt
ggcatcgatctgaatcgggcgggcaccccgctgctcgagatcgtctccgagccggatctg
cggaccgccaaggaagcggtggcgtacatgaagaagatgcactcgctcgtccgctatctc
gggatctgtgatggcaacatgcaggaaggcagctttcgctgtgacgccaacgtctcggtg
cggcccgtcggtcagcttgcgtttggcacccgagcggaaatcaagaacctgaactcgttc
cgctttgtggagcgggcgatcaactacgagattgagcgccaaatcgaggtgctcgaggac
ggcggcaccatcacccaggagactcggctgtttgattcagaccgtggggaaacgcgggcg
atgcggggcaaggaagaggccaacgattatcgctatttccccgacccggacttgctgccg
ctcgagatcaccccggcactcatcgatgaggttcgcgacgagctgcctgagctgcctgac
gccaagcgcaaccgcttcgtggccgattatggcctctctgattacgacgccgccaattta
acggccagccgggatttggcggattatttcgaggcggttgccgggcgttgcagcgacgcc
aaactggctgctaactgggtgatgggcgagctctcaggggcgctcaaccgcgaggggctc
gagattggtgaaacgccagtagacgccgaggcgctggctaatctgctgcgacgaatcctg
gatgacaccatctcgggcaagatcgccaaagaggtcttcgaggccatgtggcagggcgag
ggcgatgccgacgccgtgattgccgatcgcggtctcgagcaggtcaccgactcgagcgcg
attgaggcgctggttgatgaggccattgcggctaaccccgagcaactcgagcagtaccgg
gcgggcaagaccaaattgatgggctttttcgtgggtcaggtcatgaaggcctgcggcggc
aaggcgaatccccagcaagtcaatgaaatcctaaaacagcgcctggacggttaa

DBGET integrated database retrieval system