KEGG   Swingsia samuiensis: E3D00_03185Help
Entry
E3D00_03185       CDS       T06080                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ssam  Swingsia samuiensis
Brite
KEGG Orthology (KO) [BR:ssam00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E3D00_03185 (ahpF)
Enzymes [BR:ssam01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     E3D00_03185 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_oxidored FAD_binding_2 Thi4 Glutaredoxin DAO AlaDh_PNT_C NAD_binding_8 FAD_binding_3 Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: QDH16689
UniProt: A0A4Y6UGJ9
LinkDB All DBs
Position
complement(690750..692312)
Genome map
AA seq 520 aa AA seqDB search
MLQDDLKSQMRAYMQYLRNDVVLQASLGSDARSKEMRDLLEDIASLSDKVTFSDAGQSDR
RPSFTIRRAGSSEEVSFAGIPMGHEFTSLVLALLQVSGHPPKVDEDIIEQIKALKGDLKF
ETYFSQSCQNCPDVVQALNTISVLNPNIKHTAIDGADFQAEVEKLGIRSVPQVYLNGEPF
SSGRLDIAGILGKLDTSSVEKAAEKLNDTAPFEVLVLGAGPAGATAAIYAARKGLRTGLI
ADRFGGQVMDTAGIENFISVKETDGPKLSAELEAHVRQYDVQIISGQRAAQLVPAERTGG
LHEIVLESGAKLRSKTVILATGASWRQLSVPGEDDYRTKGVAYCPHCDGPFYKGRPVVIT
GGGNSGVEAAIDLANIVSHVTLLQRGPRLKADKVLQDKLLSLPNVTVHTNALTTHIEGNG
EEVTCLVYKDEHGEEKRINTDGVFVQIGLIPNTEWLKGALDLSSHGEIIVDDHGATSVPG
VFAAGDATTVPYKQIVIAMGEGAKASLAAFDYMIRLPVEA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaggacgacctgaaaagccagatgcgcgcctatatgcagtacctgcggaatgat
gtcgtgctgcaagcgagccttggctctgatgcgcgttcaaaagaaatgcgtgatttgctg
gaagacatcgccagtttatcagacaaggttacattctctgacgccggtcaatccgacaga
cgtccctcctttaccattcgtcgcgcaggctcttctgaagaagtttctttcgcgggcatt
ccaatggggcatgaatttacgtcccttgttttagcgcttttgcaagtgagtggtcatccg
cccaaagtagatgaagatattatagagcaaattaaggctctcaagggtgatctaaaattt
gaaacatatttttctcaatcttgccagaactgcccagatgtggtgcaggcactgaataca
atcagtgttctgaaccccaatattaaacatactgccattgatggtgctgattttcaggca
gaggtagaaaagctagggatacgttctgttccgcaggtttatctcaatggagaaccattc
tcttctggacgcctggatattgctgggattctcggaaaactggatacaagttcagttgag
aaggcggcggagaaattgaatgataccgcaccttttgaagtgcttgttctaggtgctggt
ccagcgggagcaacagcggctatttatgctgcgcgtaaaggactgcgtaccggtctaatt
gcggatcgttttggcggccaagtgatggatacggctggcattgagaatttcatttccgtt
aaagaaaccgatggaccaaagctttctgctgagttggaagcgcatgtacgtcaatatgat
gtacaaatcatctctgggcagcgggctgctcaattggtcccagcagagcgtacgggggga
ttgcatgaaatcgtgttagaaagcggggcaaagctacgttctaagacggttatattggca
acaggtgcgagctggcggcaactaagtgtaccgggagaggatgactaccgcacgaaaggt
gttgcgtattgcccgcattgtgacggcccattttataaagggcgcccggtggtcattaca
ggcgggggaaatagtggtgttgaagctgcgattgatctggccaatattgtttcgcacgta
acgttgcttcaaagaggcccacgtttgaaagcggataaagtcttgcaagataagcttttg
agcttaccaaatgtgactgttcacaccaacgctttaacaactcatattgaggggaatggt
gaagaagtcacctgccttgtttataaagatgagcatggtgaagaaaagcgcattaataca
gatggtgtgtttgttcagattggcctgattccgaatactgaatggttaaaaggtgcgctg
gatctaagttcacatggtgaaatcattgtggatgaccatggagcaacttctgttccgggc
gtatttgcagcaggtgatgcaacgacagtcccttataagcaaattgttattgcgatggga
gaaggtgcaaaagcttctttagccgcttttgattatatgatccgtctacctgttgaggcg
taa

DBGET integrated database retrieval system