KEGG   Sphingomonas sanxanigenens: NX02_02715Help
Entry
NX02_02715        CDS       T03929                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00061  Fatty acid biosynthesis
ssan00780  Biotin metabolism
ssan01100  Metabolic pathways
ssan01130  Biosynthesis of antibiotics
ssan01212  Fatty acid metabolism
Module
ssan_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NX02_02715
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NX02_02715
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    NX02_02715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ssan01004]
    NX02_02715
Enzymes [BR:ssan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     NX02_02715
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     NX02_02715
Lipid biosynthesis proteins [BR:ssan01004]
 Fatty acid synthase
  Component type
   NX02_02715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AHE52301
UniProt: W0A5H2
LinkDB All DBs
Position
complement(561506..562279)
Genome map
AA seq 257 aa AA seqDB search
MTPLVDLKGKRGLVIGIANEHSIAAGCAEAFARCGARLAATYLNDKAKDWVQPVVDQLGI
EWTAPCDVRIPGELEALFAQVQERWGGLDFLLHSIAFAPKEDLHGRVVDSSAQGFSIAMD
VSCHSFLRMAKLAEPLMATGGCLLCVTFYGSERVVEHYNLMGPVKAALESATRYVAAELG
AKAIRAHAISPGPIATRAASGIDRFDELLDRAAAQVPAGKLVDVSDVGALAAFLVSDAAK
GITGTVIPVDNGQHLFA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgcttgtggatctgaaagggaagcgcggcctcgttatcggcatcgcaaacgaa
catagcatcgcggcagggtgcgcggaggcatttgcccgatgcggagcccggcttgccgct
acctatctcaacgacaaggcaaaggactgggtccagcctgtcgtcgaccagctcggcatc
gaatggactgcgccgtgcgacgtacgcatccccggcgaactcgaggcgcttttcgcccaa
gtgcaagaacgctggggcggcctcgatttcctgctgcactcgatcgccttcgcgccgaag
gaggatctccacggtcgggtggtcgacagcagtgcgcaaggcttctcgatcgcgatggac
gtgtcctgccacagcttccttcgcatggcgaagctcgccgaaccgctgatggcgacgggc
ggatgcctgctttgcgtgaccttctatggttcggagcgggtggtcgagcactataacctg
atgggccccgtcaaggcggcgctggaaagcgcgacgcgctatgtcgccgcggaactgggc
gccaaagccatccgggcacatgccatttcaccggggccgatcgccacccgcgccgcgagc
gggatcgaccggttcgacgaactgctcgatcgggctgccgcgcaggttcccgcaggaaaa
ttggttgacgtcagcgacgtcggcgcgctggccgccttcctcgtcagcgatgccgcgaag
gggatcaccggcacggtcattccggtcgataacggacagcatcttttcgcgtga

DBGET integrated database retrieval system