KEGG   Sphingomonas sanxanigenens: NX02_02785Help
Entry
NX02_02785        CDS       T03929                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
ssan  Sphingomonas sanxanigenens
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    NX02_02785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AHE52315
UniProt: W0A9G0
LinkDB All DBs
Position
complement(575642..576427)
Genome map
AA seq 261 aa AA seqDB search
MDIAAIPWAELAPFILIGLFAQTIDSALGLGFGVLSNSLLVLFGTPPIAASSATRTAESF
TSGAAGMAHILQRNVDWPLFARLAVPGVIGGVAGIWVLYFLKSDILRPVLLVYLIAVGAY
LLWRAPRRPFAFRRIRLVAPLGFLGGFLDSSGGGGWGPLVTGNLLAQGMTPRIAVGTANA
AEFFVTVTVLTAFVGIHGLQFTNAATGILIGGLVAAPFGAWLTRRMPPKLLLQLVGVLLV
ATSIWSLASLMFERLPVFPRI
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggacatagcggcgatcccctgggccgagcttgcgccctttattctcattggcctgttc
gcccagactatcgacagtgcgctggggttgggtttcggcgtgctgtccaattccctgctt
gtcctgttcggcactccaccgatcgcggcttcttccgcgacgcgcacggccgagagcttc
accagcggcgcggcgggcatggcgcatatcttgcagcgcaatgtcgactggccgctcttt
gcccggctcgcagtcccgggcgtaatcggcggtgtcgcagggatctgggtgctctatttc
ctcaagagcgatattttgcggcccgtgctgctcgtctatctgatcgcggtcggcgcctac
ctgttatggcgcgcgccgcgcaggccgtttgccttccgcaggatcaggctggttgctccg
ctaggctttctcggaggtttcctcgacagctcaggcggtggcggctgggggccgctggtg
accggtaatctcctggcccagggcatgaccccgcgcatagccgtcggtacggccaatgct
gcggaattcttcgtgaccgtcacggtcctcactgccttcgtcggcattcacggcctgcag
ttcaccaacgccgcgaccggcatcctgatcggcggcctcgtggcagcgcctttcggcgcc
tggttgacacggcgcatgccgcccaagctactgctgcaacttgtcggggtgctgctggtc
gccaccagcatctggagcctggcgtcactcatgttcgaacgcctgcctgtctttccgcgt
atctga

DBGET integrated database retrieval system