KEGG   Sphingomonas sanxanigenens: NX02_03910Help
Entry
NX02_03910        CDS       T03929                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00052  Galactose metabolism
ssan00511  Other glycan degradation
ssan00600  Sphingolipid metabolism
ssan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NX02_03910
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    NX02_03910
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    NX02_03910
Enzymes [BR:ssan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     NX02_03910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C DUF4982 Glyco_hydro_2 Glyco_hydro_2_N BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: AHE52535
UniProt: W0AA55
LinkDB All DBs
Position
complement(800122..802827)
Genome map
AA seq 901 aa AA seqDB search
MIARGTTSIALALTLAAVTASPARAAREEIRISADWRFTKGDPQGLATDLRYDIRPDASD
TGDGKLADARPDAAVATEDAGLKVLKPWILPSANAFIADPAKRHQRPAGNPGGDVSYVQP
GFDDTDWQRVDLPHDWAIAGPFITEGPYGGMGRLPSWGIGWYRKALSIPAADRGKSIFLD
VEGAMSYATVWLNGKLVGGWPYGYNSFRLDLTPYAVPGGANILVIRLDNPPASARWYPGG
GLYRDIWLTKTDPVHVGQWGGIVRTPDVSKDRATIAVDLTVDNDGAAPAEVSATTSIYAL
DAAGTRAAKPVATLAPQRASIGARASAVLKASTSLASPRLWGPPPTQQPNRYVAVSTISR
GGRVVDRYETAFGIRTIAMDPNRGVIVNGEHIPLRGVNNHHDLGALGAAFNRRAAQRQLE
ILRDMGTNALRMSHNPPAPALLDLADEMGFLVMDEVFDSWERKKTPLDFHLIFPDWQEPD
LRAMLRRDRNHPSIIIWSVGNEVGEQYTGEAGADIARQLVKIVHEEDPMRPTTNAMNYAK
ADMPLPGAVDVISLNYQGTGIRGIIGQYPAFRAAFPNKVILSTESASALSSRGEYLFPVA
GNISGPVRPWSGGNPDTHQVSAYEMHAADFGSSPDRVFAADDQHPYVAGEFVWTGFDYLG
EPTPYYTSRSSYSGIIDLAGFPKDRFWLYQARWRPDLRFAHILPHWNWAGREGQITPVHV
FSSADEAELFVNGKSQGRIKKRDYEYRFRWDYVTYAPGEVRVETWKAGQPWATASVRTTG
APAKLELIPDRKEITADGRDLSFVTVRVLDKDSALVPDAKPAVRFTVSGPGEIVATDNGD
PTDMTAFPEPQRKAFNGLALAIVRAMPGRGGAMALRVEADGLAPAEVKVKVKVKVMGVRG
M
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcacgtgggacgacatctatcgcgctggcgctgacgcttgccgccgtcactgca
tcccccgcccgcgccgcgcgcgaggaaatccggatctcggctgactggcgcttcaccaag
ggcgacccgcagggcctcgccaccgacctgcgctacgacatccgcccggacgccagcgac
accggcgacggcaagctcgccgatgcccggccggatgcagcggtcgccaccgaggatgcc
gggctcaaggtgctcaagccctggatcctgcccagcgccaacgccttcatcgccgacccc
gcgaaacgccaccagcgccccgccggcaaccccggcggcgatgtttcctacgtccagccc
ggcttcgacgacacagactggcagcgcgtcgacctgccgcatgactgggcgatcgccggc
cccttcatcactgaagggccctatggcggcatgggtcggctgccgagctgggggatcggc
tggtaccgcaaggcgctgagcatccccgcggcggacaggggcaagtcgatcttcctcgat
gtcgagggggcgatgtcctacgccaccgtctggctcaacgggaagctcgtcggcggctgg
ccctatggctataacagcttccggctggacctgacgccctatgccgtgcccggcggcgcc
aacatcctggtcatccggctggacaatccccccgcctcggcgcgctggtatccgggcggt
ggcctctatcgcgacatctggctgaccaagaccgatccggtccatgtcggccagtggggc
ggcatcgtccgcacgccggacgtcagcaaggatcgcgcgacgatcgcggtcgacctgacc
gtcgacaacgacggcgcggcgcccgccgaggtcagcgccaccacctcgatctatgcactc
gatgccgcaggcacgcgggccgcgaagcccgtcgccaccttggcgccgcagcgcgcgagc
atcggcgcgcgcgccagcgcggtgctcaaggccagcaccagcctcgccagcccgcgcctg
tgggggccgccgccgacgcagcagcccaaccgctatgtcgcggtctccacgatcagccgc
ggcggccgcgtcgtcgatcgctacgagaccgcgttcggcatccgcacgatcgcgatggat
cccaaccgcggcgtgatcgtcaacggcgagcacatcccgttgcgcggagtgaacaatcat
cacgatctcggcgcgctcggcgccgcgttcaaccgccgcgccgcacagcgccagctcgag
atcctgcgcgacatgggcaccaacgcgctgcgcatgagccacaatccgcccgcccccgcc
ctgctcgacctcgccgacgagatgggcttccttgtgatggacgaggtgttcgattcctgg
gagcgcaagaagaccccgctagacttccacctgatcttccctgactggcaggagccggac
ctgcgcgcgatgctgcggcgggatcgcaaccatccctcgatcatcatctggagcgtcggc
aacgaggtcggcgagcaatataccggggaggccggggcggacatcgcccgccagctggtg
aagatcgtgcacgaggaggatccgatgcgccccaccaccaacgcgatgaactatgccaag
gcggatatgccgctgcccggcgcggtggacgtgatcagcctcaactatcagggtaccggc
atccgcggcatcatcggccagtatccggcgtttcgcgccgcctttccgaacaaggtgatc
ctcagcactgaaagcgcctcggcgctcagcagccggggcgaatatctgttcccggtggcg
ggcaatatcagcggcccggtgcgcccttggtcgggcggcaacccggatacgcaccaggtg
agcgcctatgagatgcacgcggcggacttcggctcctcccccgaccgcgtcttcgctgcc
gacgaccagcatccctatgtcgccggtgagttcgtgtggaccggcttcgactatctcggt
gaaccgacaccctattacacctcgcgcagttcctattcggggatcatcgatctcgcgggt
ttccccaaggaccgcttctggctctaccaggcgcgctggcggcccgacctgcgcttcgcc
cacatcttgccgcactggaactgggcgggccgcgaggggcagatcacgcccgtccacgtc
ttctcctcggcagacgaggcggaactgttcgtcaacggcaagtcgcagggccgcatcaag
aagcgcgactatgaatatcgcttccgctgggactacgtcacctacgccccgggcgaggtc
cgcgtggaaacctggaaggccggccagccctgggctacggcgtccgttcgcaccaccggc
gcgcccgcgaagctggaactgatccccgaccggaaggagatcaccgccgacggccgcgac
ctgagtttcgtgacggtccgcgtgctcgacaaggacagcgccctggtgcccgacgccaag
ccggcggtgcgcttcacagtgtcaggccccggcgagatcgtcgccaccgacaatggcgac
ccgaccgacatgaccgccttcccggaaccccagcgcaaggccttcaacggcctggcgctg
gcgatcgtacgtgcgatgccggggcgtggcggcgcgatggcgctgcgggtcgaggcggac
ggactggcaccggcggaggtgaaggtgaaggtgaaggtgaaggtgatgggggtgcggggg
atgtga

DBGET integrated database retrieval system