KEGG   Sphingomonas sanxanigenens: NX02_07480Help
Entry
NX02_07480        CDS       T03929                                 

Definition
(GenBank) hypothetical protein
  KO
K01821  4-oxalocrotonate tautomerase [EC:5.3.2.6]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00362  Benzoate degradation
ssan00621  Dioxin degradation
ssan00622  Xylene degradation
ssan01100  Metabolic pathways
ssan01120  Microbial metabolism in diverse environments
ssan01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NX02_07480
   00622 Xylene degradation
    NX02_07480
   00621 Dioxin degradation
    NX02_07480
Enzymes [BR:ssan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.2  Interconverting keto- and enol-groups
    5.3.2.6  2-hydroxymuconate tautomerase
     NX02_07480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tautomerase Tautomerase_2 Glyco_hydro_42M CHMI
Motif
Other DBs
NCBI-ProteinID: AHE53222
UniProt: W0A9R7
LinkDB All DBs
Position
1508886..1509125
Genome map
AA seq 79 aa AA seqDB search
MMPHVIVKFYSGRSDEDKRAMADGVAAALQETMGYEVANISVSVEEVEKADWMEAVYEPD
IVRRQHQLVKRPGYGHLAG
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgcacgttatcgtgaagttctactccggccgcagcgacgaggacaagcgggcc
atggcggatggcgttgccgcggctctccaggagaccatgggctacgaggtcgcgaacatc
tccgtctcggtcgaggaggtcgagaaggccgactggatggaggcggtctacgagccggac
atcgtccggcgccagcatcagctggtgaagcggccgggctacggccacctggccgggtag

DBGET integrated database retrieval system