KEGG   Sphingomonas sanxanigenens: NX02_08950
Entry
NX02_08950        CDS       T03929                                 

Definition
(GenBank) hypothetical protein
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NX02_08950
Enzymes [BR:ssan01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     NX02_08950
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 cNMP_binding Pyr_redox DAO GIDA FAD_oxidored K_oxygenase FAD_binding_2 Thi4 NAD_binding_8 HI0933_like Lycopene_cycl NAD_binding_9 FAD_binding_3 Amino_oxidase FMO-like
Other DBs
NCBI-ProteinID: AHE53513
UniProt: W0AB42
LinkDB
Position
complement(1849103..1850758)
AA seq 551 aa
MADTESSPLDPTDPYFREAQTFPVLPREMVARICAYGREESVPDGRYVFERGQRRADFFL
VLDGSIDILMFDDCGRTQLLHSHRAGQFTGEVNLFNDRKTLVSGRAAGDTRVARIGPADF
SRMIAAEPDIGEVIMRAFILRRVGLIRHQHGGVTLIGPGHGAAMVRLNAFLTRNNYPHRV
IDTEEDETGDGFLRHFGIGANDLPVVLCDGHVLRNPASHELADCLGLSIEIDPAFVHDVT
VVGAGPAGLAAAVYAASEGLSTLIVEGTAPGGQAGTSSKIENYLGFPTGISGEALAGRAQ
MQAQKFGARIAVSRDVVSLDCSTDIYKLTLADGATIQSRAVVVATGARYRKLDLPDYDRF
EGSGIHYAATAMEAGLCANRPVVVVGGGNSAGQAAMFLSRSVSHVHMLVRGAGLAATMSN
YLIERIVASRQITLHPYCEVTGLEGDAQLSAIRWRDRQTDEEIRQEAAALFVMIGAAPNT
GWLTGCLDFDASGFIPTGTERSPFETESAGLFAVGDVRSGSVKRVASGVGEGSVVVQAIH
RFLEEQRAAGG
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggccgatacagaatcctcaccgctcgatcccaccgacccctatttcagggaagcgcag
acttttcccgtactcccgcgcgagatggtcgcgcggatttgcgcttatgggcgggaggaa
tccgtgcccgacggtcgctatgtgttcgagcgcggccagcggcgggccgacttcttcctg
gtgctcgacggatcgatcgacatcctgatgttcgacgattgcggccgcacgcagttgctc
cattcacaccgcgccggacagttcaccggcgaggtcaacctgttcaacgatcgcaagacg
ctggtgagcggccgcgccgccggcgacacccgcgtcgcgcgcatcggtccggccgacttc
agtcggatgatcgcggcggaacccgatatcggcgaagtcatcatgcgcgcgttcatcctg
cgccgcgtcgggctgatccgccaccagcatggcggcgtcaccctgatcggccccggccac
ggcgccgcgatggtgcggctcaacgccttcctgacgcgcaacaactatccgcaccgggtg
atcgacaccgaggaagacgaaaccggcgatggcttcctgcgccacttcgggatcggtgcg
aacgacctgccggtggtgctgtgcgacgggcacgtgctgcgcaaccccgccagtcacgaa
ttggccgactgccttgggctctcgatcgagatcgaccccgcgttcgtgcatgacgtgacg
gtggtcggcgccggccctgcggggctcgccgcggcggtctatgccgcgtccgaagggctc
tcgacattgatcgtcgagggcaccgcacccggcggccaggccggcaccagttccaagatc
gagaattatctcggcttccccaccggcatttcgggcgaggcactggccggacgcgcgcag
atgcaggcgcagaagttcggtgcgcggatcgccgtgtcgcgcgacgtcgtctcgctcgac
tgcagcacggacatctacaagctgaccctggcggacggcgccacgattcagtcccgcgcc
gtggtggtcgcgaccggcgcgcgctatcgcaagctcgacctgcccgattacgaccggttc
gaaggatccggcattcattatgccgccaccgcgatggaggccgggctctgcgccaaccgc
cccgtcgtcgtggtcggcggcggcaattccgcgggacaggcggcgatgttcctgtcgcgc
agcgtctcgcacgttcacatgctcgtgcgcggcgccggtcttgccgcgacgatgtccaac
tatctgatcgagcggatcgtcgcctcgcggcagatcacgctccacccctattgcgaggtt
acgggactggagggcgacgcgcagctctccgcgatccgctggcgcgatcgccagacggac
gaggagatccggcaggaagccgcggcgctgttcgtgatgatcggcgctgcgcccaacacc
ggctggctcaccggctgcctcgatttcgacgcatccggcttcatccccaccggcaccgag
cgttcgcctttcgaaaccgagagcgccggtctgttcgcggtcggcgacgtgcgcagcggt
tcggtcaagcgcgtcgcctcgggcgtcggcgaaggatcggtggtagtgcaggcgatccac
cgctttctggaagagcagcgcgcggcgggcggctag

DBGET integrated database retrieval system