KEGG   Sphingomonas sanxanigenens: NX02_10235Help
Entry
NX02_10235        CDS       T03929                                 

Definition
(GenBank) hypothetical protein
  KO
K02554  2-keto-4-pentenoate hydratase [EC:4.2.1.80]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00360  Phenylalanine metabolism
ssan00362  Benzoate degradation
ssan00621  Dioxin degradation
ssan00622  Xylene degradation
ssan01100  Metabolic pathways
ssan01120  Microbial metabolism in diverse environments
ssan01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    NX02_10235
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NX02_10235
   00622 Xylene degradation
    NX02_10235
   00621 Dioxin degradation
    NX02_10235
Enzymes [BR:ssan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.80  2-oxopent-4-enoate hydratase
     NX02_10235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAA_hydrolase
Motif
Other DBs
NCBI-ProteinID: AHE53764
UniProt: W0A749
LinkDB All DBs
Position
complement(2099857..2100648)
Genome map
AA seq 263 aa AA seqDB search
MTSEGIAHRFVDARLSAGVVPDYPGEMPQSLSDAYAIQAQAIPRMGATIGGWKVGRILGD
WVARTGGAHHLAGPIFADTIFDLSDDSPALIFEDGFGAAEAEFLLRVGAAPEAGKTAFTL
EEAAALIDAVHIGFEIASSPFPGINDHGPAITISDFGNNNGLLIGPAIAEWRTSGFEDAE
VSTTIDGAAVGTGKASAFVDGTIGSVRFLFENLARRGLPITPGQWVSTGAVTGVHKVTVG
QRVEADFGRFGTIGCTIGAQQPR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcagaggggatcgcccatcgtttcgttgacgccaggctgagcgccggcgtggtg
ccagactaccccggcgagatgccgcaatcgctgagcgacgcctatgccattcaggcgcaa
gcgattccgcggatgggcgcgacgatcggcggctggaaggtcggccgcatcctgggcgac
tgggtcgcccgcaccggcggcgcgcaccatctcgccggcccgatcttcgccgacaccatc
ttcgatctttccgacgacagcccggcgctgatctttgaggatggcttcggtgcggcggag
gccgaattcctgctgcgcgtcggtgccgcgcccgaagcgggcaagaccgcgttcacgctg
gaagaggccgcagcgctgatcgatgcggtgcatatcggcttcgagatcgccagttcgccc
ttcccgggcatcaacgatcatggcccggcgatcacgatcagtgatttcggcaacaataac
ggattgttgatcggccccgccatcgccgagtggcgcaccagcggattcgaggacgccgag
gtcagcacgacgatcgacggcgcggcggtcggcaccggcaaggccagcgcgttcgtcgac
ggcacgatcggatcggtacgcttcctgttcgaaaacctcgcgcggcgcggtttaccgatc
acgccgggccaatgggtctcgacgggcgcggttaccggtgtacataaggtcaccgtcggc
cagcgcgtcgaagcggacttcggccggttcggaacgattggctgcacgatcggggcgcaa
cagccgcgctga

DBGET integrated database retrieval system