KEGG   Sphingomonas sanxanigenens: NX02_10990
Entry
NX02_10990        CDS       T03929                                 

Definition
(GenBank) hypothetical protein
Organism
ssan  Sphingomonas sanxanigenens
SSDB
Motif
Pfam: Pyr_redox_3 cNMP_binding Pyr_redox_2 Fer4_7 Fer4_10 Fer4_11 Fer4_9 Fer4_6 K_oxygenase HI0933_like Pyr_redox NAD_binding_8 Fer4 GIDA Fer4_21 NAD_binding_9 FAD_binding_3 FAD_binding_2 Fer4_8 FAD_oxidored Fer4_16 Fer4_2 Lycopene_cycl DAO Thi4 Fer4_17 Fer4_3 GF_recep_IV AlaDh_PNT_C IlvN
Other DBs
NCBI-ProteinID: AHE53910
UniProt: W0ADZ8
LinkDB
Position
2259955..2262456
AA seq 833 aa
MTDLYRIAIVGSGPAGLSAAARAAQLGISHVLLEKTDHLSDTIYKYQLGKHVMATPSQLV
LRSDMDFDAGKRETVLGTWERQAAENRIHVKYDAEVTAITGSKGDFALKLKSGETVRAEQ
VVLGIGTQGNPNLMRVPGGDLPHVQYTLDNPKAYVDEHISVIGAGDAGIENALGLADDPA
QQNVVTIVNRSMEFSTAKDANIKALLAAEAAGRVTVLRGTTPQKVEPGWVTYDTRDGERR
VRCDRIIARMGSAPPRRFVELCGAAFEERDGKKERVAGTGIRFTSDERVSYPELSRTFES
TVPGIYVIGALAGYPLIKHCMNQGYDVVEFINGNMSLKPADEPILIEKFKEMPGSRSVDE
WLEYLRTRIKIFNGMSQLQMREFMLDSEARTYRAGELVFERNTPGSSLFGIADGAVDIEV
NPTDPDIKVTVGKGSIFGEVGLISGRRRGATVRAKMGTIAVEVSRSAALKLQSTVPSAKQ
AIARISTERQLLQLFGSGVTADDLDDVIATSEIITIPAGKAVINEGEDGKDVFVIRSGSM
IVEKMIGGKPVFLSYLPAGSYVGEMSLIAGGRRTATVKAAVKAEVIKLQGDMFEALLRRK
PDLLAKAKRDMAARQDVNAYIEASKDSFSGAVDLYSSVSNFLIGEGIGEATDVLLIDENL
CVGCDNCEKACADSHDGLSRLDREAGKTYAHLHVPTSCRHCEHPHCMADCPPNALHRGQD
GEVYIDDSCIGCGNCQRNCPYGVIRMDSTPPPKPSLLSWLFLGTGPGPGEPSKAWSYKHS
DPAAEKPKKAIKCDMCAGITGGPACVRACPTGAAIRVAPDDFLSIARLQRESS
NT seq 2502 nt   +upstreamnt  +downstreamnt
gtgaccgacctctaccggatcgccatcgttggctccgggcctgcggggctcagcgcggct
gcgcgtgcggcgcagctcggcatcagccatgtgctgctcgaaaagaccgatcatctttcg
gatacgatctacaaataccagctcggcaagcatgtgatggcgacgccgtcccagctcgtc
ctgcgctccgacatggatttcgacgccggcaagcgcgagacggtgctgggaacctgggaa
cgccaggcggccgaaaaccgcatccatgtgaaatatgatgccgaagtcaccgcgatcacc
ggcagcaagggggatttcgccctcaagctgaagagtggcgagacggtgcgcgccgagcag
gtcgttctcggcatcggcacgcagggcaatcccaatctgatgcgcgtgcccggcggcgat
ctgccgcacgtgcaatatacgctcgacaaccccaaggcctatgtcgacgaacatatcagc
gtgatcggcgccggcgatgccgggatcgagaatgcgctgggcctggcggacgatcccgcg
cagcagaatgtcgtgacgatcgtcaaccggtcgatggaattcagcaccgccaaggatgcc
aacatcaaggcgctgctggcggccgaagccgcggggcgcgtgaccgtccttcgcggcacg
acgccgcagaaggtggagcccggctgggtcacttacgatacccgcgacggcgaacggcgg
gtccgctgcgaccggatcatcgcgcgcatgggatcggcgccgccgcgccggttcgtcgaa
ttgtgcggtgccgcgttcgaggagcgcgacggcaagaaggaacgcgtcgccggcacgggc
atccgcttcacgagcgacgaacgcgtatcctatcccgaactctcgcggacgttcgaatcg
acggttcccggcatctatgtgatcggcgcgctggcaggctatccgctgatcaagcactgc
atgaaccagggctatgacgtcgtcgagttcatcaatggcaatatgtcgctgaagcctgcc
gacgagccgatcctgatcgaaaagttcaaggagatgcccggttcgcgctccgtcgacgag
tggctggaatatctccgcacccgcatcaagatcttcaacggcatgtcgcagctgcagatg
cgcgagttcatgctcgacagcgaggcgcggacctatcgcgcgggcgaactggtcttcgaa
cgcaacacccccggatcctcgctgttcggcatcgccgatggcgcggtcgacatcgaggtg
aacccgaccgatcccgacatcaaggtgacggtcggcaaggggtcgatcttcggcgaggtc
gggttgatttcgggccgccgccgcggcgccaccgtgcgcgccaagatgggcacgatcgcg
gtcgaggtgtcgcgttcggcggcgctgaagctgcaatcgaccgtgccctcggccaagcag
gcgatcgcgcggatttccaccgagcgccagttgctgcaattgttcggatcgggcgtgacc
gccgacgatctcgacgacgtgatcgcgacctcggagatcatcacgatcccggcgggcaag
gcggtgatcaacgagggggaggatggcaaggacgtcttcgtcatccgatcgggctcgatg
atcgtcgagaagatgatcggcggcaagccggtgttcctctcctacctgcccgccggatcc
tatgtcggcgagatgtcgctgatcgcgggcgggcggcgcacggccacggtgaaagcggcg
gtgaaggcggaggtcatcaagctgcagggcgacatgttcgaggcgctgctgcgccgcaag
cccgacctgctggccaaggccaagcgcgacatggccgcgcgccaggacgtcaacgcctat
atcgaggcctcgaaggacagtttctcgggcgcggtcgacctctattcgtccgtctccaac
ttcctgatcggcgagggcatcggcgaggcgaccgatgtgctgctgatcgacgagaatctg
tgcgtcggctgcgacaattgcgaaaaggcctgcgcggacagccatgacggcctgagccgc
ctcgatcgtgaggcgggcaagacctatgcgcacctccacgtgccgacgagttgccggcat
tgcgagcatccgcactgcatggccgattgcccgcccaacgcgctgcaccgcgggcaggac
ggcgaagtctatatcgacgacagctgcatcggctgcggcaactgccagcgcaactgcccc
tatggcgtgatacggatggacagcacgccgccacccaagccgtcattgctcagctggctg
ttcctcggcaccggccccgggcccggcgagccgagcaaggcttggtcctacaagcattcc
gatccggcggccgaaaagcccaagaaggcgatcaagtgcgacatgtgcgccggcataacc
ggtggccccgcatgcgtgcgcgcctgtccgaccggcgccgcgatccgggttgcgcccgac
gattttctctcgatcgcacggctgcagcgggaaagcagctga

DBGET integrated database retrieval system