KEGG   Sphingomonas sanxanigenens: NX02_11185
Entry
NX02_11185        CDS       T03929                                 

Definition
(GenBank) hypothetical protein
  KO
K00529  3-phenylpropionate/trans-cinnamate dioxygenase ferredoxin reductase component [EC:1.18.1.3]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00071  Fatty acid degradation
ssan00360  Phenylalanine metabolism
ssan01100  Metabolic pathways
ssan01120  Microbial metabolism in diverse environments
ssan01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NX02_11185
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    NX02_11185
Enzymes [BR:ssan01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.3  ferredoxin---NAD+ reductase
     NX02_11185
SSDB
Motif
Pfam: Pyr_redox_2 Reductase_C Pyr_redox NAD_binding_8 GIDA DAO Pyr_redox_3 FAD_binding_2 FAD_binding_3 HI0933_like AlaDh_PNT_C Thi4 UDPG_MGDP_dh_N TrkA_N GARP NAD_binding_7 3HCDH_N
Other DBs
NCBI-ProteinID: AHE53949
UniProt: W0A7N2
LinkDB
Position
complement(2301173..2302450)
AA seq 425 aa
MAGRGAEGWESDLSVRDKYDVLIVGAGHGGAQAAVVLRQLKFEGTIALLGDENEPPYERP
PLSKDYLSGDKSFERILIRPQAFWGERGVDLLLGRRVASVDPKAHSVTLSDGAVVGYGKL
IWATGGTPRRLTCPGGDAIGVHSVRNREDVDKIVEELPAVTEAVVIGGGYIGLEAAAVLS
KFNKKVTLLEALDRVLARVAGEQLSRFYEEEHRAHGVDLRTGVTVESLACSDGRVSGAVL
ADGSVVPAQLVIVGIGIVPAVGPLLEAGAAGGNGVDVDEYCRTSLPDVYAIGDCAAHFNG
FAGGAQMRVESVQNANDQAATAARDIAGEPQSYNAVPWFWSNQYDLRLQTVGLSVGHDEA
VLRGDPATRSFSVVYLKAGKVIALDCVNATKDYVQGRALVVGGLGPDRAALADATVPLKM
LVPAG
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggcaggccgcggggccgaagggtgggagagcgatttgagcgttcgagacaaatatgat
gtgctgatcgtgggcgccgggcatggtggcgcgcaggcggcggtggtgctccgccagctc
aagttcgaaggcacgatcgcgttgctgggcgacgagaacgagcccccttacgaacggccg
ccgctttccaaggattatctctccggcgacaagtcattcgagcgcatcctgattcggccc
caggccttctggggcgaacgcggcgtggatctgctgctcgggcgccgtgtcgcgtcagtg
gatcccaaggcgcacagcgtgacgctgagcgatggcgcggtggtcggctatggcaagctg
atctgggcgacgggcggcacgccgcgtcgcctgacgtgtccgggcggcgacgccatcggc
gtccattcggtgcgcaaccgtgaggatgtcgacaagatcgtggaagagctccccgcggtc
accgaggcggtcgtgatcggcggcggctatatcggcctcgaagctgcggcagtgctgagc
aagttcaacaagaaggtgacgctgctcgaggcgctcgatcgggtgctggcgcgcgtcgcc
ggggagcagctgtcgcgcttctatgaagaagaacatcgtgcgcacggcgtcgatctgcgc
accggcgtcaccgtcgaatcgctcgcatgcagcgatggccgcgtgtcgggcgcggtgctg
gccgatggcagcgtggtgccggcccagctcgtcatcgtcggcatcggcatcgtgcctgcg
gtcggcccgctgctggaggctggcgcggccggtggcaatggcgtggacgtcgacgaatat
tgccgtaccagcctgccggacgtctatgcgatcggcgattgcgccgcgcatttcaatggc
ttcgcgggcggtgctcagatgcgggtcgaatcggtccagaacgccaacgaccaggcggcg
accgcggcccgcgatatcgccggcgagccgcagtcctataacgccgtgccctggttctgg
tcgaatcaatatgatctgcggctccagaccgtgggcctgtcggtggggcatgacgaggcg
gtgttgcgcggcgatcctgcaacgcgctctttctccgtcgtctacctgaaggcgggtaag
gtgatcgcgctcgactgcgtcaacgcaaccaaggactatgtccagggccgcgcgcttgtg
gtgggcggacttggccccgaccgagccgcgcttgccgacgcgacggtgccgctcaagatg
ctggtacccgccggctga

DBGET integrated database retrieval system