KEGG   Sphingomonas sanxanigenens: NX02_11485
Entry
NX02_11485        CDS       T03929                                 

Definition
(GenBank) hypothetical protein
Organism
ssan  Sphingomonas sanxanigenens
SSDB
Motif
Pfam: DAO FAD_binding_2 Pyr_redox_2 NAD_binding_8 FAD_oxidored FAD_binding_3 GIDA Pyr_redox_3 HI0933_like Lycopene_cycl Thi4 Trp_halogenase AlaDh_PNT_C
Other DBs
NCBI-ProteinID: AHE54008
UniProt: W0ACK1
LinkDB
Position
complement(2371956..2373263)
AA seq 435 aa
MKVSREADVASLLAPPAGSSLWLATAPAGPALPPLAGEVQADTLVIGGGIAGTTTALHLA
EAGIDTVLLEAGQVGDGASGQSGGVIAPDFIRHTPETLGRVLGRQAATRLTQMIGGSARD
VFGLIERHAIDCDAHQDGFYTPAHSEGLAENQRRYANQWHSRGYDVGFIEAEAARATFGA
DRYCGALYFGDGGRLNPLAYARGLARAAARQGARLFAGSPVVALTHAAGQWRAQTPGGTV
IARRLVLAANGGNAALHPALRRTALPLQVIQFASTPLSPAQRQEIMPMGGAFTDKVPYLF
TARLDGSGHLISAFGASFLVRGEKAALREAERRLKQHFAAMPDPRIAYLWPGTAWVNPSL
LPEVYELGDDAFAIQACNGRGITVNTAIGIEMAAMLARGDRDALSVPMRAPRPIRFHAAA
TLVPKMLMSMAYLSN
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgaaagtgtcgcgtgaagcggacgtcgcgagcctcctcgcgccgcccgcgggttcatcc
ctgtggctggcaaccgcacccgccgggccggcgctgccaccgctcgcgggcgaggtgcag
gccgatacgctcgtaatcggtggtggcatcgccggcaccaccaccgcgctgcatctggcc
gaagccggcatcgacacggtgctgctcgaagccgggcaggtgggcgatggcgccagcggc
cagagcggcggcgtcatcgcgccggacttcatccggcatacgccggagacgctggggcgg
gtgctcggccggcaggcggcgacgcggctgacgcagatgatcggcgggtcggcgcgcgac
gtgttcggcctgatcgagcgccacgcgatcgattgcgacgcgcatcaggacgggttctac
acgccggcgcacagcgaggggttggccgagaaccagcgccgctacgccaatcaatggcat
tcgcgcggctacgacgtgggcttcatcgaggcggaggcggcacgcgcgaccttcggcgcc
gatcgctattgcggcgcgctgtattttggcgatggcggccggctcaacccgctcgcctat
gcgcgcgggctggcgcgggccgcggcccggcagggcgcgcggctgttcgccggcagcccg
gtcgtcgcgctgacccacgcagcagggcagtggcgggcgcagacgccggggggcacggtg
atcgcgcggcggctggtgctggcggcgaatggcggtaacgccgcgctgcacccggcgctg
cgccgcaccgcattgccgctgcaggtgatacagttcgccagcacgccgctttcgccggcg
caacggcaggaaatcatgccgatgggcggcgcctttaccgacaaggtgccctacctcttt
accgcccggctcgatggctcgggccacctgatctccgccttcggggcatccttcctcgtg
cggggcgagaaagcggcgctgcgcgaggcggagcggcggctgaagcagcatttcgcggcg
atgcccgatccgcgcatcgcctatctctggccgggcacggcctgggtcaacccgtcgctg
ctgcccgaggtctatgagctgggcgacgatgcgttcgcgatccaggcatgcaatggccgc
ggcatcaccgtgaacaccgcgatcggcattgagatggcggcgatgctggcgcggggcgac
cgcgacgcgctgtcggtgccgatgcgcgcgccgaggccgatccgtttccacgccgcagcg
acactggtgccgaaaatgctgatgtcgatggcatatctgtccaactga

DBGET integrated database retrieval system